SecReT6
Protein ID: 123442912
SecReT6 ID171
T6SS typei3
Gene symbolclpB5
Locus tagYE2696
StrainYersinia enterocolitica subsp. enterocolitica 8081
Repliconchromosome [GenBank: NC_008800] [Browse all T6SS(s) in this replicon]
Location [Strand]2929324..2931996 [-]
ProductClp ATPase
NoteTssH
UniProt IDA1JTN2
KEGG IDyen:YE2696
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.50E-39, Aligned region: 230..310
AAA_2 [PF07724], Evalue: 3.50E-39, Aligned region: 618..784
AAA [PF00004], Evalue: 4.20E-21, Aligned region: 232..363
AAA [PF00004], Evalue: 4.20E-21, Aligned region: 623..709
ClpB_D2-small [PF10431], Evalue: 2.20E-16, Aligned region: 790..862
AAA_5 [PF07728], Evalue: 2.10E-13, Aligned region: 232..310
AAA_5 [PF07728], Evalue: 2.10E-13, Aligned region: 622..738
Sigma54_activat [PF00158], Evalue: 9.80E-08, Aligned region: 228..248
Sigma54_activat [PF00158], Evalue: 9.80E-08, Aligned region: 622..722
AAA_22 [PF13401], Evalue: 9.60E-07, Aligned region: 232..312
AAA_22 [PF13401], Evalue: 9.60E-07, Aligned region: 366..398
AAA_22 [PF13401], Evalue: 9.60E-07, Aligned region: 513..546
AAA_22 [PF13401], Evalue: 9.60E-07, Aligned region: 620..642
AAA_22 [PF13401], Evalue: 9.60E-07, Aligned region: 684..709
AAA_16 [PF13191], Evalue: 2.70E-06, Aligned region: 209..248
AAA_16 [PF13191], Evalue: 2.70E-06, Aligned region: 270..310
AAA_16 [PF13191], Evalue: 2.70E-06, Aligned region: 481..532
AAA_16 [PF13191], Evalue: 2.70E-06, Aligned region: 620..658
AAA_16 [PF13191], Evalue: 2.70E-06, Aligned region: 687..710
AAA_16 [PF13191], Evalue: 2.70E-06, Aligned region: 786..821
AAA_25 [PF13481], Evalue: 4.50E-06, Aligned region: 232..305
AAA_25 [PF13481], Evalue: 4.50E-06, Aligned region: 620..648
AAA_19 [PF13245], Evalue: 9.80E-06, Aligned region: 230..254
AAA_19 [PF13245], Evalue: 9.80E-06, Aligned region: 620..644
AAA_14 [PF13173], Evalue: 1.60E-05, Aligned region: 232..322
AAA_14 [PF13173], Evalue: 1.60E-05, Aligned region: 621..704
IstB_IS21 [PF01695], Evalue: 6.70E-05, Aligned region: 226..254
IstB_IS21 [PF01695], Evalue: 6.70E-05, Aligned region: 622..641
IstB_IS21 [PF01695], Evalue: 6.70E-05, Aligned region: 732..752
IstB_IS21 [PF01695], Evalue: 6.70E-05, Aligned region: 800..848
AAA_29 [PF13555], Evalue: 7.10E-05, Aligned region: 223..255
AAA_29 [PF13555], Evalue: 7.10E-05, Aligned region: 620..647
Zeta_toxin [PF06414], Evalue: 7.60E-05, Aligned region: 232..248
Zeta_toxin [PF06414], Evalue: 7.60E-05, Aligned region: 610..662
NACHT [PF05729], Evalue: 0.00017, Aligned region: 232..265
NACHT [PF05729], Evalue: 0.00017, Aligned region: 506..541
NACHT [PF05729], Evalue: 0.00017, Aligned region: 622..649
AAA_17 [PF13207], Evalue: 0.0003, Aligned region: 232..249
AAA_17 [PF13207], Evalue: 0.0003, Aligned region: 376..405
AAA_17 [PF13207], Evalue: 0.0003, Aligned region: 622..657
Arch_ATPase [PF01637], Evalue: 0.001, Aligned region: 211..245
Arch_ATPase [PF01637], Evalue: 0.001, Aligned region: 286..382
Arch_ATPase [PF01637], Evalue: 0.001, Aligned region: 621..667
AAA_23 [PF13476], Evalue: 0.0038, Aligned region: 232..252
AAA_23 [PF13476], Evalue: 0.0038, Aligned region: 463..538
AAA_23 [PF13476], Evalue: 0.0038, Aligned region: 620..647
AAA_18 [PF13238], Evalue: 0.0039, Aligned region: 232..249
AAA_18 [PF13238], Evalue: 0.0039, Aligned region: 624..651
TIP49 [PF06068], Evalue: 0.0058, Aligned region: 232..252
TIP49 [PF06068], Evalue: 0.0058, Aligned region: 281..312
TIP49 [PF06068], Evalue: 0.0058, Aligned region: 622..657
SRP54 [PF00448], Evalue: 0.0092, Aligned region: 231..256
SRP54 [PF00448], Evalue: 0.0092, Aligned region: 621..643
Protein Sequence: 890 a.a.     [Download]
>gi|123442912|ref|YP_001006887.1| Clp ATPase [Yersinia enterocolitica subsp. enterocolitica 8081]
MAITRKNLFGKLDATLFKGIESATTICKLRGNPYVELIHWLNQLWHQEDNDLKHIVRYFAVDVDAFERGL
AQALARLPVGATSISDFSYHIELAIERAWVYASLECLDTRIRSGHLLLAMLTNMELRRALLAIAPEMEKI
PLEHLSSDFNFITQASPETNEAATDGSPMYDGTLPGEASNAINGKSTATLAQYTTDLTALAREGKIDPVL
GRNHEISTMVDILLRRRQNNPLLTGEAGVGKTAVVEGLALAIVAGEMPPALSQVSLLTLDVVALSAGASM
KGEFEARLKNVLDEAMASPTPVILFIDEVHTLVGAGGNAGTGDAANLLKPALARGQLRTIGATTWSEFKR
HIEKDPALTRRFQVLQVDEPDEDTAISMLRGLTPALEKHHGVWIMDEALQAAVRLSHRYIPARQLPDKAI
SLLDTACARVAVAQFSQPAELQQLTFQSETAQTELSSLEKAQHFGKGQDERTALLEATIAQHSAAANKLE
QRWQAERELVTAITATRTVLYELVSQPTPDEEKRQQYQQQLAQLEEQLLLIRSAQPLVQAEVNATVIANI
VADWTGIQVGQMLKDDIRAVMELPQRLEERVIGQPHALVQLSENIMTARAGMADPRKPLGVFMLVGPSGV
GKTETALAIAESMYGGEQNLITINMSEYQESHTVSSLKGSPPGYVGYGEGGVLTEAVRRKPYSVVLLDEI
EKAHSDVHELFFQVFDKGQMEDGEGRFIDFKNTILLLTSNVGSELLSNLFADPDTAPDQDGILSALQPEL
LKVFPAAFLGRVTVIPYLPLQQSALQHIVRLHLDRIGQRLQSQHQLTLQYSDVVVDDVVSRCSVAETGAR
MLIRYIEQNITPEIGKFILRDHDAIPNQIVFVDKVENKFTVSVLNEKINN
 
Nucleotide Sequence: 2673 bp     [Download]
>gi|123440403|ref|NC_008800.1|:c2931996-2929324 Yersinia enterocolitica subsp. enterocolitica 8081 chromosome, complete genome
GTGGCTATTACAAGGAAAAATCTTTTCGGCAAACTGGATGCCACTCTTTTCAAAGGTATTGAAAGTGCGA
CAACGATTTGTAAATTGCGTGGCAACCCTTATGTAGAATTGATTCATTGGTTGAACCAACTTTGGCATCA
AGAAGATAACGATCTTAAACATATTGTTCGCTATTTTGCTGTTGACGTAGATGCTTTTGAACGTGGCCTG
GCTCAAGCACTTGCCCGCTTGCCCGTCGGTGCGACCAGTATTTCAGATTTTTCATACCATATAGAATTAG
CCATCGAACGGGCATGGGTGTACGCCAGCCTGGAGTGTTTAGATACACGTATTCGCAGCGGACATTTGTT
GCTGGCAATGCTAACCAATATGGAATTGCGCCGGGCACTGTTGGCTATTGCTCCAGAAATGGAAAAAATT
CCACTGGAGCATTTGAGCAGCGATTTTAACTTTATTACGCAGGCATCGCCGGAAACCAATGAAGCGGCCA
CCGATGGTAGCCCAATGTATGACGGCACATTACCGGGTGAAGCCAGTAATGCTATTAACGGCAAAAGTAC
CGCGACATTGGCGCAGTACACCACGGATCTGACTGCATTAGCTCGTGAAGGCAAGATAGACCCGGTACTG
GGGCGCAACCATGAAATCAGTACGATGGTGGATATTTTACTGCGTCGTCGACAAAACAACCCGTTGCTCA
CCGGTGAAGCTGGCGTGGGTAAAACGGCCGTAGTTGAAGGTCTGGCACTGGCCATTGTCGCGGGTGAAAT
GCCTCCCGCACTGAGTCAGGTGAGTCTGCTAACCCTGGATGTTGTGGCTCTTTCGGCGGGTGCCAGCATG
AAAGGCGAGTTTGAAGCACGCCTGAAGAATGTCTTAGACGAAGCAATGGCTTCACCAACGCCTGTCATCC
TGTTTATAGATGAAGTTCACACTCTGGTCGGTGCGGGGGGAAATGCAGGAACCGGTGATGCAGCTAATTT
ACTCAAACCGGCACTGGCGCGCGGTCAATTGCGCACCATTGGCGCGACAACCTGGAGTGAGTTTAAACGC
CATATTGAAAAGGATCCGGCGCTAACTCGTCGTTTCCAGGTACTTCAGGTCGATGAACCTGATGAAGATA
CTGCTATTTCGATGCTGCGTGGATTGACTCCGGCGTTAGAGAAGCACCACGGCGTATGGATCATGGATGA
AGCCTTGCAAGCTGCGGTGCGATTATCGCATCGTTATATCCCTGCGCGCCAGTTACCGGATAAAGCGATT
AGCTTGCTTGACACCGCTTGTGCACGTGTTGCCGTCGCACAATTCTCACAACCGGCAGAATTGCAGCAAT
TGACTTTCCAGAGTGAAACCGCGCAAACCGAGTTGTCATCGCTGGAAAAAGCCCAACATTTCGGCAAAGG
GCAGGACGAGCGCACAGCACTGTTAGAAGCCACGATTGCCCAACATTCAGCCGCGGCAAACAAGCTTGAA
CAACGTTGGCAGGCAGAGCGTGAATTGGTTACTGCCATTACGGCTACGCGAACGGTGCTGTATGAACTGG
TGTCGCAACCCACGCCTGATGAAGAAAAACGCCAGCAGTATCAGCAGCAATTGGCGCAACTTGAAGAGCA
ATTATTGCTTATTCGCAGTGCGCAGCCTTTGGTACAAGCTGAGGTTAATGCAACCGTGATCGCCAACATT
GTTGCGGATTGGACCGGGATTCAAGTAGGGCAAATGCTCAAAGACGATATTCGTGCCGTGATGGAGCTAC
CGCAACGTCTCGAAGAGCGAGTGATTGGTCAGCCGCATGCATTAGTCCAGTTGAGCGAAAATATTATGAC
TGCACGTGCGGGGATGGCAGACCCAAGGAAACCGCTGGGTGTCTTTATGTTGGTTGGCCCTTCCGGGGTG
GGTAAAACAGAAACGGCATTGGCCATTGCGGAAAGTATGTATGGTGGTGAGCAAAACCTTATCACAATTA
ATATGAGCGAATACCAAGAGTCACACACGGTTTCCTCATTAAAAGGCTCGCCTCCAGGCTACGTGGGATA
CGGCGAAGGTGGTGTATTAACCGAGGCAGTACGGCGTAAACCTTATAGTGTTGTGCTGTTAGATGAAATT
GAAAAAGCACATTCAGATGTCCATGAACTGTTCTTCCAGGTATTTGATAAAGGCCAGATGGAAGATGGCG
AAGGACGGTTTATTGATTTTAAAAACACTATTTTGCTGTTAACCAGCAATGTGGGTAGCGAATTATTAAG
TAACTTATTTGCTGATCCAGATACTGCTCCCGATCAAGATGGAATATTAAGTGCGTTGCAACCTGAATTG
CTGAAAGTATTCCCCGCCGCATTTTTGGGTCGCGTCACTGTGATTCCTTATTTGCCGCTCCAGCAGAGCG
CGTTGCAGCATATTGTTCGATTACATTTAGATCGTATCGGCCAGCGTTTGCAGTCTCAGCATCAGCTGAC
GTTGCAATACAGTGATGTGGTCGTTGACGATGTAGTTAGCCGCTGCTCAGTAGCAGAAACAGGCGCCCGT
ATGCTTATTCGTTATATTGAACAGAATATTACACCTGAAATTGGTAAATTTATTTTACGTGACCACGACG
CAATACCTAACCAGATCGTGTTCGTCGATAAAGTCGAAAATAAATTCACGGTTTCTGTGCTGAATGAAAA
GATAAATAATTAA
 Primer design