SecReT6
Protein ID: 123442913
SecReT6 ID171
T6SS typei3
Gene symbol-
Locus tagYE2697
StrainYersinia enterocolitica subsp. enterocolitica 8081
Repliconchromosome [GenBank: NC_008800] [Browse all T6SS(s) in this replicon]
Location [Strand]2932716..2934596 [+]
Producthypothetical protein
NoteTssF
UniProt IDA1JTN6
KEGG IDyen:YE2697
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.60E-204, Aligned region: 5..625
Protein Sequence: 626 a.a.     [Download]
>gi|123442913|ref|YP_001006888.1| hypothetical protein YE2697 [Yersinia enterocolitica subsp. enterocolitica 8081]
MDHKFLDYYNKELTFMREMAQEFADKHPKIAGRLGMHGIEVADPYVERLIESFCFLSARTQIKLDAEFPK
FTQRLLDIVYPNYNSPTPSMGVIQLKPNLKEGDLTQGYNVPRGSSFFTHIAPGETTRCEFRSGQDVGLWP
LEITEARLSSIPPDMPNLEKHRIAYHRLKGALRIKLKLVGDLQFSQLAGLDRLPIYINGDERIVSHIFEL
LHASHVATIIRAGHGVTAEDTVISNDALAFEGLSPDQSLLPLSWNIFHGHNLMQEYFTCRQRFYFFTLTQ
LSKSLSNNHTNEAEIIILLDRLPQELVSHVAPSRFLLNCTPVINLFQKRMDKIEINRALNDFHVVPDRSR
PLDYEVFSITKVFGQQAETSKEVVFNPLYQTRHCDNGNFGRYFSITRKPRTSQNNKRKYDTRTPYASTEV
FVSLVDQQEAPYGDNLRYLSIEAQVTNRDLPRLITSNGNFELTMSDSAPVHGAHFVFQPSPPRAPFAIDE
SAWRLIRQLSFNYLPLSDMTHANGGESLRNMLRLFVSASDLESNTQIDALVGCKSEPVIRRLPGNGLLVY
GRGICCTLTVDEEGFSGISPYLFGLIMENYLARHAAINVFTETELHSMQRGRVGQWKARPGRRGVL
 
Nucleotide Sequence: 1881 bp     [Download]
>gi|123440403|ref|NC_008800.1|:2932716-2934596 Yersinia enterocolitica subsp. enterocolitica 8081 chromosome, complete genome
GTGGATCACAAATTTCTTGATTACTATAATAAAGAACTGACTTTTATGCGCGAAATGGCGCAGGAATTCG
CCGATAAGCATCCTAAAATAGCGGGCCGCTTAGGCATGCACGGGATTGAAGTTGCCGACCCCTATGTCGA
ACGCCTGATCGAGTCTTTCTGCTTTCTCTCTGCCAGAACACAAATTAAGCTGGATGCCGAATTCCCCAAA
TTTACTCAGCGCTTGCTGGATATTGTCTATCCCAATTACAACTCTCCCACCCCGTCAATGGGAGTGATTC
AACTTAAGCCAAACCTAAAAGAGGGTGATCTGACCCAGGGCTATAATGTCCCTCGTGGCAGTTCGTTTTT
CACCCATATTGCCCCAGGTGAAACGACCCGTTGTGAATTTCGCAGTGGGCAGGATGTTGGATTATGGCCG
CTGGAGATAACAGAAGCACGCCTAAGCTCCATTCCTCCCGATATGCCAAATCTGGAAAAGCACCGTATTG
CCTATCATCGACTAAAGGGTGCCTTGCGCATTAAGCTAAAACTGGTCGGCGACCTGCAATTTTCGCAACT
AGCAGGGTTAGATCGCCTGCCTATCTATATCAATGGTGACGAGAGGATAGTCTCCCACATCTTTGAACTT
CTGCATGCCAGCCATGTTGCAACTATCATCCGTGCAGGGCACGGCGTGACAGCTGAAGATACCGTGATAA
GCAATGACGCTCTTGCTTTTGAGGGGTTAAGCCCCGATCAAAGCCTGTTACCACTGTCGTGGAATATTTT
TCATGGCCATAACCTGATGCAGGAATACTTCACCTGCCGCCAGCGATTCTATTTTTTCACACTGACTCAG
TTGTCCAAAAGTCTAAGCAATAATCACACCAACGAAGCGGAGATTATTATCTTACTGGACCGGTTGCCAC
AGGAGCTGGTGAGTCATGTTGCCCCCTCTCGCTTCCTATTGAACTGCACCCCGGTGATTAATCTATTCCA
GAAGCGCATGGACAAGATTGAGATTAATCGTGCACTGAATGACTTTCACGTGGTGCCAGACCGAAGCCGA
CCGCTCGATTACGAAGTTTTCTCCATCACGAAAGTCTTTGGTCAACAAGCGGAAACCAGTAAAGAGGTGG
TATTTAACCCCCTCTACCAAACCCGCCATTGCGACAATGGCAATTTTGGTCGCTATTTTTCCATTACCCG
TAAGCCCAGAACGAGTCAGAACAATAAGCGTAAATATGACACTCGTACGCCTTATGCCAGTACTGAGGTC
TTCGTTTCGCTGGTTGATCAACAAGAAGCGCCCTACGGCGATAACCTGCGGTATTTATCCATTGAGGCGC
AGGTGACTAACCGAGATCTGCCGCGGTTGATTACCAGTAATGGCAATTTTGAATTAACCATGTCGGATTC
AGCGCCAGTACACGGCGCGCACTTTGTATTTCAGCCCAGCCCCCCTCGGGCCCCTTTTGCGATAGATGAA
TCTGCCTGGCGGTTAATCCGTCAGCTCAGTTTTAACTACTTGCCATTATCTGATATGACTCATGCTAATG
GGGGGGAGTCGCTACGTAACATGCTGCGTCTGTTTGTTAGCGCCTCAGATCTTGAATCGAATACCCAAAT
CGATGCACTGGTTGGCTGCAAAAGCGAGCCGGTAATCAGACGACTGCCCGGTAACGGCTTACTGGTTTAT
GGTCGTGGGATCTGTTGCACCTTGACCGTTGATGAAGAAGGGTTCTCCGGCATCAGTCCCTATCTGTTTG
GCTTGATCATGGAAAACTATTTGGCACGCCACGCCGCGATCAATGTGTTTACCGAGACTGAACTGCACTC
GATGCAAAGAGGACGTGTCGGTCAGTGGAAAGCCCGTCCTGGTCGCCGGGGAGTGCTGTAA
 Primer design