SecReT6
Protein ID: 123442914
SecReT6 ID171
T6SS typei3
Gene symbol-
Locus tagYE2698
StrainYersinia enterocolitica subsp. enterocolitica 8081
Repliconchromosome [GenBank: NC_008800] [Browse all T6SS(s) in this replicon]
Location [Strand]2934596..2935621 [+]
Producthypothetical protein
NoteTssG
UniProt IDA1JTN9
KEGG IDyen:YE2698
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.10E-89, Aligned region: 21..321
Protein Sequence: 341 a.a.     [Download]
>gi|123442914|ref|YP_001006889.1| hypothetical protein YE2698 [Yersinia enterocolitica subsp. enterocolitica 8081]
MQPDDSIQQQSQLNLDTWYQQAEPWNAGFISMMRANAARTPDMPAPAKAMLPKQESFRIGQSANMAFSPR
EIAHVEMKDGKMDLQLFGLGIWGPHGAMPLQMTELAYTRAELHDHTLTDFADLFHHRALSQLYRAWFVSQ
DTASLDRQHDEKFSFYIGSLAGLDPAELTHSALPVHAHLASSAHLIREARNPEGLVGALQYYFEVPVSMV
EYAQQWIFLDKSDQTQLGDGASAMLLGDGAILGDTVLDRQHKFELILGPLSLQQYLRFSPSGQDLPVLRE
WVRNFVGFEYAWEVQLLLTAAEVPTATLEGTSQLGYTSWLAREDVSANVRGMSFEPEMHRY
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|123440403|ref|NC_008800.1|:2934596-2935621 Yersinia enterocolitica subsp. enterocolitica 8081 chromosome, complete genome
ATGCAACCCGACGACAGCATACAGCAGCAGAGCCAACTCAATCTGGATACCTGGTATCAGCAAGCAGAGC
CCTGGAATGCCGGTTTTATCAGCATGATGCGGGCTAATGCGGCCCGAACTCCCGATATGCCCGCTCCCGC
TAAAGCTATGCTGCCGAAACAAGAAAGCTTCCGTATCGGACAAAGTGCCAATATGGCGTTCTCACCACGT
GAGATTGCCCATGTTGAAATGAAAGACGGGAAGATGGACCTACAGCTTTTTGGTCTGGGTATCTGGGGGC
CGCACGGCGCGATGCCGTTGCAAATGACTGAACTGGCCTACACCCGCGCTGAGTTGCATGACCATACACT
GACCGACTTTGCCGATCTATTTCATCATCGGGCGCTATCACAGCTCTATCGTGCATGGTTTGTCTCTCAG
GACACCGCTTCACTTGACAGGCAACATGATGAGAAATTCTCTTTTTATATCGGCAGCCTGGCCGGTTTAG
ACCCAGCGGAACTGACACATAGTGCGCTGCCGGTGCATGCTCATCTGGCTTCATCCGCCCATCTTATTCG
TGAAGCACGTAACCCCGAAGGCTTAGTCGGCGCATTGCAATACTACTTTGAAGTGCCGGTCAGCATGGTC
GAATACGCCCAACAGTGGATCTTTCTGGATAAAAGTGACCAGACGCAATTGGGCGATGGTGCCTCGGCGA
TGCTGTTAGGTGACGGTGCCATTCTGGGCGACACCGTTTTAGACCGACAGCATAAATTCGAGCTGATACT
TGGCCCGCTCAGCCTGCAACAGTATTTGCGTTTCAGCCCATCAGGACAGGATTTACCGGTATTACGTGAA
TGGGTTCGTAACTTTGTCGGATTTGAATATGCCTGGGAGGTGCAATTGTTGTTAACCGCCGCTGAGGTTC
CAACCGCCACATTGGAGGGCACCAGCCAGTTGGGGTACACCAGTTGGTTAGCCCGAGAGGATGTCTCAGC
CAACGTACGCGGAATGAGTTTTGAACCCGAAATGCACCGTTATTAA
 Primer design