SecReT6
Protein ID: 123442915
SecReT6 ID171
T6SS typei3
Gene symbol-
Locus tagYE2699
StrainYersinia enterocolitica subsp. enterocolitica 8081
Repliconchromosome [GenBank: NC_008800] [Browse all T6SS(s) in this replicon]
Location [Strand]2935696..2936859 [+]
Producthypothetical protein
NoteTssA
UniProt IDA1JTP1
KEGG IDyen:YE2699
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.40E-16, Aligned region: 62..121
Protein Sequence: 387 a.a.     [Download]
>gi|123442915|ref|YP_001006890.1| hypothetical protein YE2699 [Yersinia enterocolitica subsp. enterocolitica 8081]
MSVPSIADSRGYYHRLMQPIPGDHPCGLSLEYDSAFLMLQTKLQPKLTAEYGNFVEVAEPTNWTDTERKC
LELLGKARDIRLLIILMRCRMRQIGVSAVQEGLEALLWCLSAWPDDLHPQLLDEGEFEPFMRANAFAELD
DIDGFIADFRNQPLPKAAGMQISVKELEKAHSFPREDGALEEATLEAIEHDWQARSDSAILSLQKAYALL
LELTTNLSHSLGEVTPDFVRLTAVLRHFGGSNMADIAPIAAFETPEYITATEATEVYTTAPEWQPEEIVT
AVSIPTDTATPTYPPAPHMSPLQQPPLQSPPPIAVAAQVPIAPKGIQNRADALSRLIEVRQWFATTEPSS
PVIALLSFSEKTIGKSFGELLQIIPPELISKLDAGQE
 
Nucleotide Sequence: 1164 bp     [Download]
>gi|123440403|ref|NC_008800.1|:2935696-2936859 Yersinia enterocolitica subsp. enterocolitica 8081 chromosome, complete genome
ATGAGTGTACCAAGTATTGCTGATAGCAGAGGTTATTATCACCGCCTGATGCAACCTATTCCAGGTGACC
ATCCTTGCGGCCTAAGTCTGGAATATGACTCAGCATTTCTGATGCTGCAAACAAAACTGCAACCCAAGTT
GACCGCCGAGTACGGCAACTTTGTTGAAGTCGCTGAGCCGACCAACTGGACCGATACCGAGCGAAAATGC
CTGGAGCTGCTAGGTAAAGCCCGTGACATTCGGTTACTGATTATTCTGATGCGCTGTCGAATGCGTCAAA
TTGGCGTAAGTGCGGTGCAGGAAGGGCTGGAAGCCCTACTGTGGTGCCTGAGTGCCTGGCCGGATGATCT
ACATCCACAGTTACTTGATGAAGGCGAATTTGAACCTTTTATGCGGGCCAATGCTTTTGCAGAATTAGAC
GATATCGATGGTTTTATTGCTGATTTTCGCAACCAACCCCTGCCCAAAGCCGCCGGAATGCAAATATCAG
TCAAAGAGCTTGAGAAAGCGCATTCGTTCCCGCGCGAAGACGGTGCACTGGAAGAAGCCACTTTGGAAGC
CATTGAGCATGATTGGCAGGCCCGTTCCGATAGCGCGATCCTCTCATTGCAAAAAGCTTATGCATTGCTG
TTGGAATTAACCACAAATCTTAGCCATTCTCTCGGTGAGGTCACCCCTGACTTCGTCAGATTGACGGCGG
TGTTACGCCACTTTGGTGGGAGCAATATGGCCGATATCGCGCCTATCGCAGCCTTTGAAACACCTGAATA
TATTACGGCAACCGAGGCCACTGAAGTCTATACAACGGCCCCGGAATGGCAGCCTGAGGAAATAGTCACC
GCGGTCAGTATCCCCACTGATACTGCGACTCCCACTTATCCGCCCGCGCCACACATGTCACCATTACAAC
AGCCACCATTGCAATCGCCACCGCCGATAGCTGTTGCGGCACAAGTTCCAATCGCGCCAAAAGGAATTCA
AAATCGCGCGGACGCGTTATCCCGACTCATTGAAGTCCGCCAATGGTTTGCGACTACCGAGCCTAGCAGC
CCGGTGATCGCGCTATTGTCATTTTCAGAAAAAACCATTGGCAAAAGCTTTGGTGAATTACTGCAAATCA
TTCCGCCAGAACTGATTTCTAAACTTGATGCAGGACAGGAGTAG
 Primer design