SecReT6
Protein ID: 123442919
SecReT6 ID171
T6SS typei3
Gene symbol-
Locus tagYE2703
StrainYersinia enterocolitica subsp. enterocolitica 8081
Repliconchromosome [GenBank: NC_008800] [Browse all T6SS(s) in this replicon]
Location [Strand]2939891..2941561 [+]
Producthypothetical protein
NoteTagL
UniProt IDA1JTP5, A1JTP5
KEGG IDyen:YE2703
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 7.10E-16, Aligned region: 442..540
UDG [PF03167], Evalue: 0.0037, Aligned region: 52..135
Protein Sequence: 556 a.a.     [Download]
>gi|123442919|ref|YP_001006894.1| hypothetical protein YE2703 [Yersinia enterocolitica subsp. enterocolitica 8081]
MFKLKLNKSLLLLWLATCGVLIASLALYENTLWNNAIFITFLALLVLTVWQHYTLKPKPSPSEPQQPPQP
VVAETAHQGNTVILILGPYAAKWFSHPGAADNTRFSSQAIWILIPDPESLQKRLKHIATHHPSAQVSAFF
PFLPDVYENTSIIISQLTKWQNSFSILSLQTPLACVFAIYIQLSEERLSHNPDNAYWTGNINLANKKEID
ITAAFQALSQKLESQDTSSTAFSSQRHAIAHNLFIWLNESGVTNSLKNLFSHTSLQLTDVILSDNGKGFI
KHGAWSVWLEKTLGILPGLASSLSRPPFPAVINWRKPQIAPVVKSTVIETPTPPRWLWSLGFATVLLAVH
MAYSLSQEKTRHDQFNQQMATLGNMSDISVQHITDNITKLTDKAKIYSNCLNIINITRWGLSQCAPLLNK
INHQIESYQDIPAFSSTQMAPMFDSNSIKLKPNAQTNETLASLLLLVEQHQGRKVLIIGHSDNTGSASFN
MTISEQRAVVVRDWLIKNSALAKEDFIIRGMGALEPVASNDTPAGQDQNRRVEVLLLPIHNKNAGA
 
Nucleotide Sequence: 1671 bp     [Download]
>gi|123440403|ref|NC_008800.1|:2939891-2941561 Yersinia enterocolitica subsp. enterocolitica 8081 chromosome, complete genome
ATGTTTAAGCTCAAATTAAATAAGTCGCTATTACTGCTCTGGTTGGCAACCTGTGGCGTATTGATAGCAA
GTCTGGCTTTGTATGAAAATACGTTATGGAATAATGCTATTTTTATTACTTTCCTTGCCCTATTGGTGCT
CACAGTATGGCAACATTACACCCTTAAACCAAAACCCTCTCCGTCAGAACCACAACAACCCCCTCAACCG
GTGGTTGCAGAAACTGCGCATCAGGGGAATACCGTCATTTTGATTCTTGGCCCCTATGCCGCCAAATGGT
TTAGTCATCCGGGAGCTGCCGATAATACACGTTTTTCCAGCCAGGCTATTTGGATCTTAATTCCTGATCC
GGAATCATTGCAAAAAAGGCTCAAACATATAGCGACACATCACCCATCTGCACAAGTATCGGCTTTTTTC
CCGTTCTTGCCTGATGTGTATGAAAATACATCAATTATCATTTCACAACTAACAAAATGGCAGAACAGTT
TTTCGATCTTATCCCTGCAAACTCCCCTCGCCTGCGTGTTTGCTATCTATATTCAGTTAAGTGAGGAACG
TCTTAGCCATAATCCTGATAATGCGTATTGGACTGGAAATATTAATCTCGCCAATAAAAAAGAGATCGAT
ATTACTGCTGCTTTCCAAGCATTGAGCCAAAAACTTGAGTCGCAAGATACTAGCAGTACGGCGTTCTCAT
CCCAGCGTCACGCAATTGCACATAATCTGTTTATTTGGTTAAACGAATCTGGCGTGACAAATAGCTTAAA
AAATCTCTTTTCCCACACATCATTACAGCTGACTGATGTGATTTTATCCGATAACGGAAAAGGGTTTATC
AAACATGGTGCCTGGTCGGTATGGCTGGAAAAAACATTGGGGATTTTACCTGGTTTGGCCTCATCCCTAT
CACGACCACCTTTCCCGGCAGTGATTAATTGGCGAAAACCACAGATAGCGCCAGTGGTCAAATCGACTGT
TATTGAAACCCCAACACCGCCGAGATGGTTATGGAGTTTGGGTTTTGCCACCGTGCTATTAGCAGTACAC
ATGGCCTATTCTTTATCGCAAGAAAAAACTCGCCATGACCAATTTAACCAACAGATGGCAACTTTGGGCA
ATATGAGCGATATATCTGTGCAACATATTACGGATAATATTACGAAGTTAACTGACAAGGCCAAAATATA
TTCTAACTGCTTGAATATAATAAATATTACACGTTGGGGATTATCTCAATGTGCACCGTTATTAAATAAA
ATAAATCACCAAATTGAAAGTTATCAAGATATCCCTGCGTTTAGTTCTACCCAAATGGCCCCGATGTTTG
ATTCAAATAGCATAAAACTGAAGCCCAATGCGCAAACAAACGAAACTCTGGCATCCTTGTTACTTCTGGT
AGAGCAGCATCAAGGCAGAAAAGTTCTCATTATCGGTCATTCGGACAATACCGGCAGTGCTTCATTCAAT
ATGACAATTTCCGAACAACGCGCAGTTGTGGTTCGGGACTGGCTAATCAAAAACAGTGCACTTGCAAAAG
AAGATTTCATTATCAGAGGAATGGGAGCATTAGAACCGGTCGCATCAAATGATACACCAGCAGGACAAGA
TCAAAATCGGCGCGTTGAAGTGCTGTTATTACCAATACATAACAAAAATGCGGGAGCTTAA
 Primer design