SecReT6
Protein ID: 124381650
SecReT6 ID174
T6SS typei3
Gene symbol-
Locus tagBMA10229_1207
StrainBurkholderia mallei NCTC 10229
Repliconchromosome II [GenBank: NC_008835] [Browse all T6SS(s) in this replicon]
Location [Strand]1262072..1264342 [+]
ProductATP-dependent Clp protease, ATP-binding subunit
NoteTssH
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.00E-38, Aligned region: 12..46
AAA_2 [PF07724], Evalue: 2.00E-38, Aligned region: 465..631
AAA [PF00004], Evalue: 2.40E-20, Aligned region: 14..145
AAA [PF00004], Evalue: 2.40E-20, Aligned region: 470..553
AAA_5 [PF07728], Evalue: 4.30E-14, Aligned region: 14..92
AAA_5 [PF07728], Evalue: 4.30E-14, Aligned region: 118..144
AAA_5 [PF07728], Evalue: 4.30E-14, Aligned region: 469..586
ClpB_D2-small [PF10431], Evalue: 9.50E-14, Aligned region: 637..707
Sigma54_activat [PF00158], Evalue: 3.00E-07, Aligned region: 11..94
Sigma54_activat [PF00158], Evalue: 3.00E-07, Aligned region: 469..568
AAA_22 [PF13401], Evalue: 1.40E-06, Aligned region: 14..95
AAA_22 [PF13401], Evalue: 1.40E-06, Aligned region: 159..181
AAA_22 [PF13401], Evalue: 1.40E-06, Aligned region: 468..491
AAA_22 [PF13401], Evalue: 1.40E-06, Aligned region: 531..555
AAA_19 [PF13245], Evalue: 5.40E-06, Aligned region: 12..37
AAA_19 [PF13245], Evalue: 5.40E-06, Aligned region: 264..289
AAA_19 [PF13245], Evalue: 5.40E-06, Aligned region: 467..495
AAA_16 [PF13191], Evalue: 6.90E-06, Aligned region: 9..31
AAA_16 [PF13191], Evalue: 6.90E-06, Aligned region: 56..92
AAA_16 [PF13191], Evalue: 6.90E-06, Aligned region: 464..513
AAA_16 [PF13191], Evalue: 6.90E-06, Aligned region: 534..557
AAA_16 [PF13191], Evalue: 6.90E-06, Aligned region: 613..670
AAA_29 [PF13555], Evalue: 3.70E-05, Aligned region: 6..32
AAA_29 [PF13555], Evalue: 3.70E-05, Aligned region: 467..494
IstB_IS21 [PF01695], Evalue: 4.50E-05, Aligned region: 8..72
IstB_IS21 [PF01695], Evalue: 4.50E-05, Aligned region: 469..489
IstB_IS21 [PF01695], Evalue: 4.50E-05, Aligned region: 540..603
AAA_25 [PF13481], Evalue: 5.90E-05, Aligned region: 14..38
AAA_25 [PF13481], Evalue: 5.90E-05, Aligned region: 248..270
AAA_25 [PF13481], Evalue: 5.90E-05, Aligned region: 467..501
NACHT [PF05729], Evalue: 7.20E-05, Aligned region: 14..42
NACHT [PF05729], Evalue: 7.20E-05, Aligned region: 469..495
AAA_18 [PF13238], Evalue: 0.00011, Aligned region: 14..49
AAA_18 [PF13238], Evalue: 0.00011, Aligned region: 470..499
AAA_17 [PF13207], Evalue: 0.00011, Aligned region: 14..33
AAA_17 [PF13207], Evalue: 0.00011, Aligned region: 469..506
Zeta_toxin [PF06414], Evalue: 0.00034, Aligned region: 14..34
Zeta_toxin [PF06414], Evalue: 0.00034, Aligned region: 253..277
Zeta_toxin [PF06414], Evalue: 0.00034, Aligned region: 468..509
AAA_14 [PF13173], Evalue: 0.0012, Aligned region: 14..94
AAA_14 [PF13173], Evalue: 0.0012, Aligned region: 468..551
Hpr_kinase_C [PF07475], Evalue: 0.0099, Aligned region: 14..26
Hpr_kinase_C [PF07475], Evalue: 0.0099, Aligned region: 467..487
Protein Sequence: 756 a.a.     [Download]
>gi|124381650|ref|YP_001025009.1| unnamed protein product [Burkholderia mallei NCTC 10229]
MTDVLLRRRQNNPLLTGEAGVGKTAVVEGLALAIANGDVPPKLADVRLMSVDVGALLAGAGMKGEFESRL
KGVLEAAAKSVAPVILFVDEIHTLIGAGGQAGTGDAANLLKPALARGTIRTIGATTWAEYKRHIEKDPAL
TRRFQVLQVPEPEEPAAVHMVRGVARAFARHHRVTVRDEAIRAAVALSHRYIPSRHLPDKAISLLDTACA
RVALSQHAAPGELQHVRQRLLAARAERDLLEQEARIGLDAGQSLAAVRKRIEALAAEEAAVDARWKAQAD
AARALLAAREAALAECHRESCAETRAGSLSESRTESRTESRARSHIDSSACAHSDVPAEMHAGSRTATRP
DTHAEAHAAPASPPPAADTPHAGAAPGLRELERALAAAQGDAPLVFPEVDEAIVAQIVADWTGIPVGRMM
TDEVAAVRALPATLEARVIGQPDALRQIGERVQTARAGLADPKKPLGVFLLAGPSGVGKTETALALAEAL
YGGEQSLITINMSEYQEAHTVSGLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEIEKAHRDVHELFFQ
VFDKGYMEDGDGRYIDFRNTTILLTSNVGAELSTSLCADASLAPDAAALRDALMPELLKVFPAAFLGRVS
VVPYRPLEARALARIVRLHLDRVVARMAERHRIALAYDDAVVDYVVGRCLVQETGARLLIGFIEQHVLPR
LSALWLDAFPSKAALARIDIGVADAAAPAARALVFRPGQASRAGPPNAPLTAVQAG
 
Nucleotide Sequence: 2271 bp     [Download]
>gi|124381141|ref|NC_008835.1|:1262072-1264342 Burkholderia mallei NCTC 10229 chromosome II, complete sequence
ATGACCGACGTGCTGCTGCGGCGCAGGCAGAACAATCCGCTGCTCACCGGCGAGGCGGGCGTGGGCAAGA
CGGCCGTCGTCGAGGGCCTCGCGCTCGCGATCGCGAACGGCGACGTGCCGCCGAAGCTGGCCGACGTGCG
CCTGATGAGCGTCGACGTGGGCGCGCTGCTGGCCGGCGCGGGCATGAAAGGCGAATTCGAATCGCGCCTG
AAAGGCGTGCTCGAGGCCGCGGCGAAATCCGTCGCGCCCGTCATCCTGTTCGTCGACGAGATTCACACGC
TGATCGGCGCGGGCGGACAGGCCGGCACGGGCGACGCGGCGAACCTGCTCAAGCCCGCGCTCGCGCGCGG
CACGATCCGCACGATCGGCGCGACGACATGGGCGGAGTACAAGCGGCACATCGAAAAGGATCCCGCATTG
ACCCGCCGCTTTCAGGTGCTGCAAGTGCCGGAGCCCGAAGAGCCGGCCGCGGTGCACATGGTGCGGGGCG
TCGCGCGAGCGTTCGCGCGGCACCACCGCGTGACGGTGCGCGACGAGGCGATCCGCGCCGCCGTCGCGCT
GTCGCACCGCTACATTCCGTCGCGGCATCTGCCGGACAAGGCGATCAGCCTCCTCGACACCGCATGCGCG
CGCGTCGCGCTCTCGCAGCACGCCGCGCCCGGCGAACTGCAGCACGTGCGCCAGCGCTTGCTCGCGGCGC
GCGCCGAGCGCGATCTGCTCGAACAGGAGGCGCGCATCGGGCTCGACGCCGGGCAATCGCTCGCGGCGGT
GCGCAAACGCATCGAAGCGCTCGCGGCCGAGGAAGCGGCCGTCGACGCGCGCTGGAAGGCGCAGGCCGAC
GCGGCGCGCGCGCTGCTCGCCGCGCGCGAGGCCGCGCTCGCGGAATGTCACCGCGAGTCTTGCGCCGAAA
CGCGCGCCGGCTCGCTTTCCGAATCTCGTACCGAATCTCGTACCGAATCGCGCGCCAGATCACACATCGA
CTCCAGCGCCTGTGCTCACAGCGACGTCCCGGCCGAAATGCACGCCGGTTCGCGCACCGCAACGCGTCCG
GACACGCACGCCGAAGCGCACGCCGCCCCCGCCTCGCCCCCGCCCGCCGCCGATACGCCGCACGCAGGCG
CCGCCCCCGGGCTGCGCGAGCTCGAACGCGCGCTCGCGGCGGCCCAGGGCGACGCACCGCTCGTGTTCCC
GGAAGTCGACGAGGCGATCGTCGCGCAGATCGTCGCGGATTGGACCGGCATTCCGGTCGGCCGCATGATG
ACCGACGAAGTCGCCGCCGTGCGCGCGCTGCCCGCGACGCTCGAGGCGCGCGTGATCGGCCAGCCCGACG
CGCTGCGGCAGATCGGCGAGCGCGTGCAGACCGCGCGCGCGGGCCTCGCCGATCCGAAGAAGCCGCTCGG
CGTATTCCTGCTTGCGGGCCCGTCGGGCGTCGGCAAGACCGAAACGGCGCTCGCGCTCGCCGAGGCGCTG
TACGGCGGCGAACAGAGCCTGATCACGATCAACATGAGCGAGTACCAGGAAGCCCACACCGTGTCGGGCC
TCAAGGGCGCGCCACCCGGCTATGTCGGCTACGGCGAGGGCGGCGTGCTGACCGAGGCGGTGCGGCGGCG
GCCGTACAGCGTCGTGCTGCTCGACGAGATCGAGAAGGCGCACCGCGACGTGCACGAACTCTTCTTCCAG
GTCTTCGACAAGGGCTACATGGAAGACGGCGACGGCCGCTACATCGATTTCCGCAACACGACGATCCTGC
TCACGAGCAACGTCGGCGCGGAACTGAGCACGAGCCTGTGTGCCGACGCATCGCTCGCGCCCGATGCCGC
CGCGCTGCGCGACGCGCTCATGCCCGAACTGCTGAAGGTCTTCCCCGCCGCGTTCCTCGGGCGCGTGAGC
GTCGTGCCGTACCGGCCGCTCGAAGCGCGCGCGCTCGCGCGCATCGTGCGCCTGCATCTGGATCGCGTCG
TCGCGCGCATGGCCGAGCGGCACCGCATCGCGCTCGCGTACGACGACGCCGTCGTCGACTACGTCGTCGG
GCGTTGCCTCGTGCAGGAAACCGGCGCGCGGCTGCTGATCGGATTCATCGAGCAGCACGTGCTGCCTCGG
CTGTCCGCGCTGTGGCTCGACGCGTTCCCGTCGAAGGCGGCGCTCGCGCGCATCGACATCGGTGTGGCCG
ACGCGGCCGCGCCCGCGGCGCGCGCGCTCGTCTTCCGGCCCGGCCAAGCAAGCCGGGCGGGGCCGCCGAA
CGCGCCGCTCACCGCCGTGCAGGCCGGCTAG
 Primer design