SecReT6
Protein ID: 124381698
SecReT6 ID172
T6SS typei1
Gene symbol-
Locus tagBMA10229_0730
StrainBurkholderia mallei NCTC 10229
Repliconchromosome II [GenBank: NC_008835] [Browse all T6SS(s) in this replicon]
Location [Strand]772728..776696 [+]
Producthypothetical protein
NoteTssM
UniProt IDA2RXX6
KEGG IDbml:BMA10229_0730
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.20E-48, Aligned region: 171..416
ImcF-related_N [PF14331], Evalue: 3.20E-48, Aligned region: 1081..1121
Protein Sequence: 1322 a.a.     [Download]
>gi|124381698|ref|YP_001024545.1| unnamed protein product [Burkholderia mallei NCTC 10229]
MMIARIAALLALAALSWASALYFDWPLWCAPAVFCAALAGWLLCRVARRALRAVRARAQLARLDASERLP
AADAPELRVAARWRTALAALGRAQPAPRLRGRPRDALPWYLVIGPEGAGKTTALARARLASPLRHARDDA
AIAPTEDCDWWCFDDAVVLDLAGRFAAPGATDDDRRAWHALLEQLGRARARRGVNGVVVAIDAPRLIEAS
RDALTIEGSAIRERLEQLIRLFDRRFPVYVLVTQCDRLYGFDEWAAQLAPEQRERAFGYLGDHDADAFVA
RALDSLDARLGALRVALAARGEPPSPRALMLPHELACLRPALEAFARAAFGPNVYQETPYLRGLLFASGR
QAGGAPSLTLPDWLDAAPARTPGDAGLFLHDVFARVLPGERDAWLPVERPSRSRLVLRRLALAAWLLASV
AAGLLMSASFVGDMRTVELVRRDYPAHPRFTGEFAHDTATLARIGRVIADVERRDERRLVRPLAGATPVG
RLEAELKRRYVAHYRRSIEPTADRLFFGKPDGASDMRAANDARLAARIRNLVRYVNLMQARRRGADRETL
AQMPAPAVARATDGGGARGVDSVGVSGVSGVSGVSGVSGGVGGVGGARAAEGAGRAVRASGGRRAGDARA
ARGMRGAAGNAGAGAEIAPAADGVRDRDEGFARVSALAVDLIAWSAPDDRALAARVAAAQAELERLAYRD
PDGAWLLALPDASMPRDVTLADFWPAAEPRTLPDAQPAALRDVRVPAALTAAHRPAIDAFLDEMAQAVAN
RPKFAFHRDAFDTWYRARRIDAWRDFVARFPQGEQGLTTQAQWRAVIDRIADHRDPFAALLARVDREFES
ERDDTLPPWLRFVRTTSHMLAPAMLAPARLPAASGGLGAALGSISRSGGRALREALGGAPEQGRLTLERD
AALRDALVDYERRVAALAADALAGPGAAYRLAADFHGFGVDPSVQASAMRAADSALRDVKRLAGDRDVGG
DVVWSLVGGPLRALIAYVERQASCALQDDWERDVLWPLRRAATRDDVEGLLYGPQGAIWAFVDGPAKPFV
RVGAARASALDTLGYRLPFTDAFLPLIDDAAARRVAQARRDAERRAQQQAALELDERIASLGKQIDALRA
QTVRFGIVAQPTDVNPDAQAKPFETVLTLQCAPQARTLTNYNLRVSEQIDWQPDRCGDATLRISLGGVTL
VRRYAGSLGVARFVQDFRYGVRRFTPRDFPDAKAQLQRLGVRHIDVRYDFSGHDALLAHVGRIDALERAR
RDDLARQRRAANRQDDDAGGATAIARAAASVANAPGAALPRRIGVCWGDPAHDRPDGDGAQP
 
Nucleotide Sequence: 3969 bp     [Download]
>gi|124381141|ref|NC_008835.1|:772728-776696 Burkholderia mallei NCTC 10229 chromosome II, complete sequence
ATGATGATCGCGCGGATCGCCGCGCTGCTCGCGCTCGCCGCGCTCAGTTGGGCGAGCGCGCTCTATTTCG
ACTGGCCGCTCTGGTGCGCGCCCGCCGTGTTCTGCGCGGCGCTCGCCGGATGGCTGCTGTGCCGCGTCGC
GCGCCGCGCGCTGCGCGCGGTTCGTGCGCGCGCGCAGCTCGCACGGCTCGACGCATCCGAGCGCCTGCCC
GCGGCCGACGCGCCGGAGCTGCGCGTCGCCGCGCGCTGGCGCACCGCGCTCGCCGCGCTCGGGCGCGCGC
AGCCCGCGCCGCGCCTGCGCGGCCGGCCGCGCGACGCGCTGCCGTGGTATCTCGTGATCGGCCCCGAGGG
CGCGGGCAAGACAACCGCGCTCGCGCGCGCGCGCCTCGCGTCGCCGCTGCGGCACGCGCGCGACGACGCG
GCCATCGCGCCGACCGAGGACTGCGACTGGTGGTGCTTCGACGACGCGGTCGTGCTCGATCTCGCGGGCC
GCTTCGCCGCGCCCGGCGCGACCGACGACGATCGCCGCGCATGGCACGCGCTCCTCGAGCAGCTCGGCCG
CGCGCGTGCGCGCCGGGGCGTGAACGGCGTCGTGGTCGCGATCGACGCGCCGCGCCTCATCGAAGCGAGC
CGCGATGCGCTGACGATCGAAGGCAGCGCCATTCGCGAACGGCTCGAGCAACTGATCCGCCTGTTCGACC
GGCGCTTTCCGGTGTACGTGCTCGTCACGCAATGCGACCGGCTCTACGGCTTCGACGAATGGGCCGCGCA
GCTCGCGCCGGAACAACGCGAGCGCGCGTTCGGCTATCTCGGCGATCACGACGCGGATGCGTTCGTCGCG
CGCGCGCTCGACAGCCTCGACGCACGGCTCGGCGCGCTGCGCGTCGCGCTGGCGGCGCGCGGCGAGCCGC
CGTCGCCGCGCGCGCTGATGCTGCCGCACGAACTCGCGTGCCTGCGGCCCGCGCTCGAGGCGTTCGCACG
CGCGGCGTTCGGCCCGAACGTCTATCAGGAAACACCGTATCTGCGCGGGCTGCTGTTCGCGAGCGGCCGG
CAGGCGGGCGGCGCGCCGTCGCTGACGCTGCCCGACTGGCTCGACGCCGCGCCGGCGCGCACGCCCGGCG
ATGCGGGCCTGTTCCTGCACGACGTGTTCGCGCGCGTGCTGCCGGGCGAGCGCGACGCGTGGCTGCCCGT
CGAGCGGCCGAGCCGCTCGCGGCTCGTGCTGCGGCGCCTCGCGCTCGCCGCGTGGCTCCTCGCGAGCGTC
GCGGCCGGGCTGCTGATGAGCGCATCGTTCGTCGGCGACATGCGAACCGTCGAGCTGGTCCGCCGCGACT
ATCCCGCGCATCCGCGCTTCACCGGCGAATTCGCGCACGACACGGCGACGCTCGCGCGGATCGGCCGCGT
GATCGCCGACGTCGAGCGGCGCGACGAGCGGCGGCTCGTGCGCCCGCTCGCCGGCGCGACGCCCGTCGGC
CGGCTCGAAGCGGAACTCAAGCGCCGCTACGTCGCACACTATCGGCGCTCGATCGAACCCACCGCCGATC
GGCTGTTCTTCGGCAAGCCGGACGGCGCGAGCGACATGCGCGCGGCCAACGATGCGCGGCTCGCCGCGCG
CATCCGCAATCTGGTCCGCTACGTGAACCTGATGCAGGCGCGCCGGCGCGGCGCGGATCGCGAGACGCTC
GCGCAAATGCCCGCACCGGCGGTCGCGCGCGCGACGGATGGCGGTGGCGCTCGCGGAGTGGACAGTGTGG
GTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTCTGGCGGTGTAGGCGGTGTAGGCGGTGC
GCGCGCCGCGGAAGGTGCGGGTCGCGCCGTCCGCGCGAGCGGCGGACGGCGCGCAGGCGACGCGCGCGCC
GCGCGCGGCATGCGCGGCGCCGCCGGCAACGCCGGCGCCGGCGCTGAAATCGCACCCGCCGCAGACGGCG
TTCGCGATCGCGACGAAGGGTTTGCGCGCGTCAGCGCGCTCGCCGTCGACCTGATCGCGTGGAGCGCGCC
CGACGATCGCGCGCTCGCCGCGCGCGTCGCGGCCGCGCAGGCAGAGCTCGAACGGCTCGCGTACCGCGAT
CCGGACGGCGCGTGGCTGCTCGCGCTACCGGATGCCTCGATGCCGCGCGACGTGACGCTCGCCGATTTCT
GGCCCGCCGCCGAGCCGCGCACGCTGCCCGACGCACAGCCCGCCGCGCTGCGCGACGTGCGCGTGCCCGC
CGCGCTGACGGCCGCGCATCGCCCGGCCATCGATGCGTTCCTCGACGAGATGGCGCAGGCGGTCGCGAAC
CGGCCGAAGTTCGCGTTCCATCGCGACGCGTTCGACACGTGGTACCGCGCACGGCGCATCGACGCATGGC
GCGACTTCGTCGCACGCTTCCCGCAGGGCGAGCAAGGGCTGACGACGCAAGCGCAATGGCGCGCGGTGAT
CGACCGGATCGCCGATCACCGCGATCCGTTCGCGGCATTGCTCGCGCGCGTCGATCGCGAATTCGAATCC
GAGCGCGACGACACGCTGCCGCCGTGGCTACGGTTCGTGCGCACGACATCGCACATGCTCGCCCCCGCGA
TGCTCGCGCCCGCGCGCCTGCCCGCGGCGAGCGGCGGCCTGGGCGCCGCGCTCGGCTCGATCTCGCGCAG
CGGCGGACGCGCGCTGCGCGAAGCGCTCGGCGGCGCACCCGAGCAAGGCAGGCTCACGCTCGAGCGCGAC
GCCGCGCTGCGCGACGCGCTTGTCGACTACGAGCGGCGCGTCGCCGCGCTCGCCGCCGACGCGCTCGCGG
GCCCCGGCGCCGCGTACCGGCTCGCGGCCGATTTCCACGGCTTCGGCGTCGATCCGTCCGTCCAGGCTTC
CGCGATGCGCGCGGCCGACAGCGCGCTGCGCGACGTCAAGCGGCTCGCGGGCGATCGCGACGTCGGCGGC
GACGTCGTCTGGAGCCTCGTCGGCGGCCCGCTGCGCGCGCTGATCGCGTATGTCGAGCGGCAGGCGTCGT
GCGCGCTGCAGGACGACTGGGAGCGCGACGTGCTGTGGCCGCTCAGGCGCGCGGCGACGCGCGACGACGT
GGAGGGTCTGCTGTACGGCCCGCAAGGCGCGATCTGGGCGTTCGTCGACGGCCCGGCGAAGCCGTTCGTG
CGTGTCGGCGCGGCGCGTGCGTCGGCGCTCGACACGCTCGGCTACCGGCTGCCGTTCACCGACGCGTTCC
TGCCGCTCATCGACGACGCGGCCGCCCGGCGCGTCGCGCAAGCGCGGCGCGACGCCGAGCGGCGCGCGCA
ACAGCAGGCGGCGCTCGAGCTGGACGAGCGGATCGCATCGCTCGGCAAGCAGATCGACGCGCTGCGCGCG
CAAACGGTGCGCTTCGGGATCGTCGCGCAGCCGACCGACGTGAACCCGGATGCGCAGGCCAAGCCGTTCG
AAACCGTGCTGACGCTGCAATGCGCGCCGCAGGCGCGCACGCTGACGAACTACAACCTGCGCGTGTCCGA
GCAGATCGACTGGCAACCCGATCGATGCGGCGACGCGACGCTGCGCATCTCGCTCGGCGGCGTCACGCTC
GTGCGCCGTTACGCGGGATCGCTCGGCGTCGCGCGCTTCGTCCAGGACTTCCGCTACGGCGTGCGCCGCT
TCACGCCCCGCGATTTCCCGGACGCGAAAGCGCAGCTTCAACGTCTCGGCGTGCGCCACATCGACGTGCG
TTACGACTTCTCCGGGCATGACGCGCTGCTCGCGCACGTCGGTCGGATCGACGCGCTCGAACGCGCGCGC
CGCGACGACCTCGCGCGGCAGCGGCGCGCCGCGAACCGGCAGGACGACGACGCGGGCGGCGCGACGGCGA
TCGCGCGGGCGGCGGCGTCCGTCGCGAATGCGCCGGGCGCCGCGCTGCCCCGCCGCATCGGCGTGTGTTG
GGGGGACCCGGCGCACGACAGGCCCGATGGCGACGGCGCGCAACCGTGA
 Primer design