SecReT6
Protein ID: 124381841
SecReT6 ID174
T6SS typei3
Gene symbol-
Locus tagBMA10229_1206
StrainBurkholderia mallei NCTC 10229
Repliconchromosome II [GenBank: NC_008835] [Browse all T6SS(s) in this replicon]
Location [Strand]1261419..1262075 [+]
ProductATP-dependent Clp protease, ATP-binding subunit ClpB
NoteTssH
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Clp_N [PF02861], Evalue: 0.00033, Aligned region: 28..74
Clp_N [PF02861], Evalue: 0.00033, Aligned region: 111..130
Protein Sequence: 218 a.a.     [Download]
>gi|124381841|ref|YP_001025008.1| unnamed protein product [Burkholderia mallei NCTC 10229]
MAISRQALFGKLGATLFRAIESATVFCKLRGNPYVELVHWLQQLLQQSDSDLHRIVRHAGIERDALDRDI
ARALAALPAGAGSISDFSHHVETAIERAWVLATLRFGDRRIRGAWLVAALVDTPELRRVLLSISPAFARI
PHDDALDDVLPAWTAGSPEAADAPYDHVDSAPASPGEPSGATRAAPNGSPLERYCTDLTARATATSPPSS
GASSKSAR
 
Nucleotide Sequence: 657 bp     [Download]
>gi|124381141|ref|NC_008835.1|:1261419-1262075 Burkholderia mallei NCTC 10229 chromosome II, complete sequence
ATGGCGATCTCGCGTCAGGCGCTGTTCGGGAAACTCGGGGCTACGCTCTTCAGGGCGATCGAATCGGCCA
CGGTTTTCTGCAAGCTGCGCGGCAATCCGTACGTCGAGCTGGTGCACTGGCTGCAGCAGTTGTTGCAGCA
GTCCGACTCCGATCTGCACCGGATCGTGCGGCACGCCGGCATCGAGCGCGACGCGCTCGATCGCGACATC
GCGCGCGCGCTCGCCGCGCTGCCGGCCGGCGCGGGCTCGATCAGCGATTTTTCCCATCACGTCGAAACCG
CGATCGAGCGCGCATGGGTGCTCGCAACGCTGCGCTTCGGCGACCGGCGCATCCGCGGCGCATGGCTCGT
CGCCGCGCTCGTCGATACGCCGGAACTGCGGCGCGTGCTGCTTTCCATTTCGCCGGCGTTCGCGAGGATT
CCTCACGACGATGCTCTCGACGACGTGCTGCCCGCGTGGACGGCCGGTTCGCCGGAAGCGGCGGACGCGC
CGTACGACCACGTCGATTCCGCGCCCGCTTCGCCGGGCGAGCCGTCCGGCGCGACGCGCGCCGCGCCGAA
CGGCTCGCCGCTCGAGCGATATTGCACGGACCTGACCGCGCGCGCGACGGCGACATCGCCCCCGTCATCG
GGCGCGAGCTCGAAATCCGCACGATGA
 Primer design