SecReT6
Protein ID: 124382472
SecReT6 ID174
T6SS typei3
Gene symbol-
Locus tagBMA10229_1213
StrainBurkholderia mallei NCTC 10229
Repliconchromosome II [GenBank: NC_008835] [Browse all T6SS(s) in this replicon]
Location [Strand]1267727..1269073 [+]
Producthypothetical protein
NoteTssK
UniProt IDA2RZ95
KEGG IDbml:BMA10229_1213
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.20E-144, Aligned region: 20..447
Protein Sequence: 448 a.a.     [Download]
>gi|124382472|ref|YP_001025015.1| unnamed protein product [Burkholderia mallei NCTC 10229]
MSWHNKVVWSEGLFMRPQLFQQQERYLEHYAHKRAAPLSPFFFGFSHFSLDSEAPALGKIIVKSASGVFA
DGTPFDAPGSTPPPAPLTIRPEHLDQVIYLAVPIRVPNGEETAFDRAAESLARYAVFETDLRDTNSIGQG
PKTVQLSNLRLRLLPEKELTDAWIGLALTRVKTIRADASIELDDMLIPPVVGYGASDTLASWLAKIHDLT
RLRANALAERLTGSDGRASTTAEVSDYLLLQTLNRYEPLLKHLQRVPTTSPAELYALLIGMAGELSTYVR
TDTRRPLDTHPPYQHVAPHLCLKPVVDDTHRLLNAVLVRSAQRLALADLGHGMLNAVVDPVDMQGFTAVV
LAVHAQMPPDLLQQQFAAQAKAGPSERLPDLVRSHLSGIALQALPVPPRQIPFNAGYVYYELARGGPLWD
EVARHGGLALHIAGEFPSLKLELWGIRG
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|124381141|ref|NC_008835.1|:1267727-1269073 Burkholderia mallei NCTC 10229 chromosome II, complete sequence
ATGAGCTGGCATAACAAGGTCGTCTGGAGCGAGGGGCTTTTCATGCGCCCGCAGCTGTTCCAGCAGCAGG
AGCGCTATCTCGAGCACTACGCGCACAAGCGCGCGGCGCCGCTGTCGCCGTTCTTCTTCGGCTTCAGCCA
CTTCAGCCTCGACAGCGAGGCGCCGGCGCTCGGCAAGATCATCGTGAAATCGGCGAGCGGCGTGTTCGCC
GACGGCACGCCGTTCGACGCGCCGGGCAGCACGCCGCCGCCCGCGCCGCTCACGATCCGGCCCGAGCATC
TGGACCAGGTGATCTACCTCGCGGTGCCGATCCGCGTGCCGAACGGCGAGGAAACCGCATTCGACCGCGC
GGCCGAATCGCTCGCGCGCTATGCCGTGTTCGAAACCGACCTGCGCGACACGAACTCGATCGGGCAAGGG
CCGAAGACGGTCCAGTTGTCGAACCTGCGCCTGCGGCTGCTTCCGGAAAAGGAACTGACGGACGCGTGGA
TCGGGCTCGCGCTCACGCGCGTGAAGACGATTCGCGCGGACGCGAGCATCGAGCTCGACGACATGCTGAT
TCCGCCCGTGGTCGGCTACGGCGCGAGCGACACGCTCGCGAGCTGGCTCGCGAAGATCCACGATCTCACG
CGCCTGCGCGCGAACGCGCTCGCCGAGCGCCTGACGGGCTCGGACGGCCGGGCGAGCACGACGGCCGAAG
TATCCGACTACCTGCTGCTGCAAACGCTCAATCGCTACGAGCCGCTGCTGAAACACCTGCAGCGCGTGCC
CACGACGTCGCCCGCCGAGCTGTACGCGCTGCTCATCGGCATGGCGGGCGAGCTGTCCACCTACGTGCGC
ACCGATACGCGCCGGCCGCTCGATACGCACCCGCCCTATCAGCACGTCGCGCCGCATCTGTGCCTGAAGC
CCGTCGTCGACGACACGCACCGGCTGCTCAACGCCGTGCTCGTGCGCAGCGCGCAGCGCCTCGCGCTCGC
CGATCTGGGGCACGGAATGCTCAACGCGGTCGTCGATCCGGTCGACATGCAGGGCTTCACCGCGGTCGTG
CTCGCGGTGCATGCGCAGATGCCGCCCGATCTGCTGCAGCAGCAGTTCGCCGCGCAGGCGAAGGCGGGGC
CGTCCGAGCGGCTGCCGGACCTCGTGCGCAGCCATCTGTCCGGCATCGCGCTGCAGGCGCTGCCGGTGCC
GCCCCGACAGATCCCGTTCAACGCCGGCTACGTCTATTACGAGCTCGCGCGCGGCGGGCCGCTGTGGGAC
GAAGTCGCGCGGCACGGCGGGCTCGCGCTGCACATCGCCGGCGAATTTCCGTCGCTGAAGCTCGAGCTAT
GGGGCATTCGCGGATAG
 Primer design