SecReT6
Protein ID: 124382493
SecReT6 ID174
T6SS typei3
Gene symbol-
Locus tagBMA10229_1216
StrainBurkholderia mallei NCTC 10229
Repliconchromosome II [GenBank: NC_008835] [Browse all T6SS(s) in this replicon]
Location [Strand]1273236..1274531 [+]
Producthypothetical protein
NoteTssM
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1215 [PF06744], Evalue: 2.60E-36, Aligned region: 24..52
DUF1215 [PF06744], Evalue: 2.60E-36, Aligned region: 133..257
Protein Sequence: 431 a.a.     [Download]
>gi|124382493|ref|YP_001025018.1| unnamed protein product [Burkholderia mallei NCTC 10229]
MLRSFAAPDSPLERLARAAVHETTLAQPEASADRSFLQKASAQLSQQADKALGVRAQERVERELVDNRFA
GLREMVTGRADTQTDARPGAPAGKSGLDAVANLLNDYYTALTVSDDALANNSMPPANDTAAKLKMAAQTM
PAPFRSVLTGLAAQGSREVNRGIGQLLSRQLQATVSDVCRLAIEGNYPFAPDSKRDVGIEDFTRVFAQGG
VIDDFFAKTLAPFVDTSTRPWRYKTLPGATEPVEGPDLEPFQHAKAIREVFFGAPGQKQMAWKADIRIPE
LDPTITSLAIDVDGQTALYQHGPVAPFAVSWPGPRGGVHAEITASPRIRPDTSAVSTDGPWALLRLLQKG
RVSGTATPGRTRVTLDFDGRKAVLDLASTGSVANPLTSDVLKTFRCPGSMPMFSLADTGAPPGLPPGSPA
APTSRVARDGR
 
Nucleotide Sequence: 1296 bp     [Download]
>gi|124381141|ref|NC_008835.1|:1273236-1274531 Burkholderia mallei NCTC 10229 chromosome II, complete sequence
GTGCTGCGCAGCTTCGCGGCGCCGGATTCGCCGCTCGAGCGGCTCGCGCGCGCGGCGGTTCACGAGACGA
CGCTCGCGCAGCCCGAAGCGAGCGCCGATCGCTCGTTCCTGCAAAAGGCGTCCGCCCAGTTGAGCCAGCA
GGCGGACAAGGCGCTCGGCGTGCGCGCGCAGGAGCGCGTCGAGCGCGAGCTCGTCGACAATCGCTTCGCG
GGCCTGCGCGAAATGGTGACGGGCCGCGCGGACACGCAAACGGACGCGCGCCCGGGCGCGCCGGCCGGCA
AGAGCGGGCTCGATGCGGTCGCGAACCTGCTGAACGACTACTACACGGCGCTGACCGTCTCGGACGACGC
GCTCGCGAACAACAGCATGCCGCCCGCGAACGATACCGCGGCGAAACTGAAGATGGCCGCGCAGACGATG
CCCGCGCCGTTTCGCTCGGTGCTGACCGGGCTCGCCGCGCAGGGCTCGCGCGAAGTGAACCGCGGCATCG
GCCAGTTGCTGTCGCGGCAGTTGCAGGCGACGGTAAGCGACGTTTGCCGCCTCGCGATCGAGGGCAACTA
TCCGTTCGCGCCCGACAGCAAGCGCGACGTCGGCATCGAGGACTTCACGCGCGTGTTCGCGCAAGGCGGC
GTGATCGACGACTTCTTCGCGAAGACGCTCGCGCCGTTCGTCGACACGTCGACGCGGCCTTGGCGCTACA
AGACGCTGCCCGGCGCGACCGAACCGGTGGAGGGCCCCGATCTCGAACCGTTTCAGCACGCGAAGGCGAT
TCGCGAAGTGTTTTTCGGCGCGCCCGGCCAGAAGCAGATGGCGTGGAAGGCCGACATCCGGATTCCCGAA
CTGGACCCGACGATCACGAGCCTCGCGATCGACGTCGACGGACAGACGGCGCTCTATCAGCACGGCCCCG
TCGCGCCGTTCGCGGTGAGCTGGCCGGGGCCGCGCGGCGGCGTGCACGCGGAGATCACCGCGAGCCCGCG
CATCCGGCCGGACACGTCGGCGGTGTCGACGGACGGCCCGTGGGCGCTGCTGCGCCTGCTTCAGAAGGGA
CGCGTGAGCGGCACGGCGACGCCCGGGCGCACGCGCGTCACGCTCGACTTCGACGGCCGCAAGGCGGTGC
TCGACCTCGCGAGCACGGGCAGCGTCGCGAATCCGTTGACGAGCGACGTGCTGAAGACGTTCCGGTGCCC
GGGCTCGATGCCGATGTTCAGTCTCGCGGACACCGGCGCGCCGCCGGGCTTGCCGCCCGGGAGCCCGGCG
GCGCCGACGTCGCGCGTCGCGCGCGACGGGCGGTGA
 Primer design