SecReT6
Protein ID: 124382991
SecReT6 ID174
T6SS typei3
Gene symbol-
Locus tagBMA10229_1202
StrainBurkholderia mallei NCTC 10229
Repliconchromosome II [GenBank: NC_008835] [Browse all T6SS(s) in this replicon]
Location [Strand]1256717..1258606 [-]
Producthypothetical protein
NoteTssF
UniProt IDA2RZ84
KEGG IDbml:BMA10229_1202
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.40E-214, Aligned region: 5..626
Protein Sequence: 629 a.a.     [Download]
>gi|124382991|ref|YP_001025004.1| unnamed protein product [Burkholderia mallei NCTC 10229]
MDPQLLDYYNQELIYMRELGAEFARAHPKIARRLGMQAGEVADPYVERLIESFCFMAARMQIKLDAEFPR
FTGRLLEVLYPNYVAPTPSMAVARLYPSRTEGNLAQGFRVARGTAFAARVPAGEKTACRFRSGQDVTLYP
LEIADARLTGIPPDIPALDRYVPAGAQVRGALRLRLRTTGNMRIADLRGLDRLPLYLAGDAQVASHLFEL
LHVAGVATLTAAPGEFAAPGRPPAAVTVDALAHEGLGADEGLLPLTWAKFHGHNLLHEYFACPERFYFVA
LTGLEEGLRRIAGSEVEIVVLLEQSPERLADVVDASRFALFCTPVINLFPRHMDRIELSSGQTECHLVPA
RLAPLDYEVFSVEAMYGQVAATSAELEFRPLYQTLNDDESNYGRYFSTRRERRLVSDFARRYGTRTPYVG
TEMFVSLVDQNEAPYSEDIRYLSVDALVTNRDLPSLVPRDGVRDLTAIESAPIDSVGLIRAPSAPKAPYA
EREIAWRLIRQLNFNYLPLDELDHRAGGQGLRGLLRLFLAGDEADSRRQVESLVGVKTRPVTRKLPGAGP
LVFGRGVECALSVDETGFSGVSPYLFGLVLEHYLARHVSINVFTQTELNSIQRGCIARWPVRMGARGGA
 
Nucleotide Sequence: 1890 bp     [Download]
>gi|124381141|ref|NC_008835.1|:c1258606-1256717 Burkholderia mallei NCTC 10229 chromosome II, complete sequence
GTGGACCCGCAATTGCTCGACTACTACAACCAGGAACTGATCTACATGCGCGAGCTCGGCGCCGAGTTCG
CGCGCGCGCACCCGAAGATTGCGCGGCGCCTCGGAATGCAGGCGGGCGAAGTGGCCGATCCGTACGTCGA
GCGGCTGATCGAATCGTTCTGCTTTATGGCCGCGCGCATGCAGATCAAGCTCGATGCGGAATTTCCGCGC
TTCACCGGCCGCCTGCTCGAGGTGCTCTATCCGAACTATGTCGCGCCGACGCCGTCGATGGCGGTCGCGC
GCCTGTACCCGAGCCGCACCGAAGGCAACCTCGCGCAAGGCTTTCGCGTCGCGCGCGGCACCGCGTTTGC
CGCGCGCGTGCCGGCCGGCGAGAAAACCGCGTGCCGGTTTCGCAGCGGCCAGGACGTGACGCTCTATCCG
CTCGAGATCGCCGACGCGCGGCTGACGGGGATTCCGCCGGACATCCCGGCGCTCGACCGCTACGTGCCGG
CCGGCGCGCAGGTGCGCGGCGCGCTGCGCCTGCGGCTGCGCACGACCGGCAACATGCGCATCGCCGATCT
GCGGGGCCTCGACCGGCTGCCGCTGTATCTCGCGGGCGACGCTCAGGTGGCCTCGCACCTGTTCGAGCTG
CTGCACGTGGCCGGCGTCGCGACGCTCACGGCCGCGCCCGGCGAGTTCGCCGCGCCAGGCCGCCCGCCCG
CGGCGGTTACCGTCGACGCGCTCGCTCACGAAGGGCTCGGCGCCGACGAGGGGCTGTTGCCGCTCACGTG
GGCGAAGTTCCATGGGCACAACCTGCTGCACGAATACTTCGCGTGCCCGGAGCGCTTCTATTTCGTCGCG
CTGACGGGGCTCGAGGAAGGGTTGCGGCGCATCGCGGGCAGCGAGGTCGAAATCGTCGTGCTGCTCGAAC
AATCGCCCGAGCGGCTCGCGGACGTCGTCGACGCGTCGCGCTTCGCGCTGTTCTGCACGCCGGTGATCAA
CCTGTTTCCGCGCCACATGGACCGGATCGAACTGTCGAGCGGGCAGACCGAATGCCATCTGGTGCCGGCC
CGCCTCGCGCCGCTCGACTACGAAGTATTTTCCGTCGAGGCGATGTACGGGCAGGTCGCCGCGACATCGG
CCGAACTCGAGTTCCGGCCGCTGTACCAGACGCTGAACGACGACGAGAGCAACTATGGACGCTATTTCTC
GACGCGGCGCGAGCGCCGGCTCGTGTCGGATTTCGCGCGCCGCTACGGCACGCGCACGCCGTACGTCGGC
ACGGAGATGTTCGTATCGCTCGTCGATCAGAACGAGGCGCCCTACAGCGAGGACATCCGCTATCTGTCGG
TGGACGCGCTGGTGACGAACCGCGACCTGCCGAGCCTCGTGCCGCGCGACGGCGTGCGCGACCTCACGGC
GATCGAATCCGCGCCGATCGACAGCGTCGGCCTGATCCGCGCGCCGTCCGCGCCGAAGGCGCCGTATGCG
GAGCGCGAGATCGCGTGGCGGCTGATCCGCCAGTTGAACTTCAACTATCTGCCGCTCGACGAGCTCGACC
ATCGCGCGGGCGGACAGGGCCTGCGCGGCCTGCTGCGGCTGTTTCTGGCGGGCGACGAGGCCGACAGCCG
GCGGCAGGTGGAAAGCCTTGTCGGCGTGAAGACGCGGCCCGTCACGCGCAAGCTGCCCGGCGCGGGCCCG
CTCGTGTTCGGGCGCGGCGTCGAGTGCGCGCTGAGCGTCGACGAAACGGGCTTCTCCGGTGTGAGCCCGT
ATCTGTTCGGGCTCGTGCTCGAGCATTATCTGGCGCGGCACGTGTCGATCAACGTGTTCACGCAGACCGA
GCTGAACTCGATCCAGCGCGGCTGCATCGCGCGCTGGCCGGTGCGCATGGGCGCGCGGGGAGGCGCGTGA
 Primer design