SecReT6
Protein ID: 124383078
SecReT6 ID174
T6SS typei3
Gene symbol-
Locus tagBMA10229_1204
StrainBurkholderia mallei NCTC 10229
Repliconchromosome II [GenBank: NC_008835] [Browse all T6SS(s) in this replicon]
Location [Strand]1259205..1260170 [-]
Producthypothetical protein
NoteTagJ
UniProt IDA2RZ86
KEGG IDbml:BMA10229_1204
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 4.60E-51, Aligned region: 149..294
Protein Sequence: 321 a.a.     [Download]
>gi|124383078|ref|YP_001025006.1| unnamed protein product [Burkholderia mallei NCTC 10229]
MTTPAFPAPPGARTSARPHDTPLDARLAAAQAAVRARPVDAASRWALFQLLCVTGQGERAVGQLQAYARF
AAQHAHIAHAYRDLIRAERFHARVMAGQARPGFVFDAPPWIDDLLEALRAQAAGARDEADRARSRALDRA
PFVAGRGPDAPFDWIADSDSRFGPVCEVVTAGHDRWLPFSDLAGWRLARPGVLLALVWAPCVLTLADGSV
AHGFMPARYPGSELADGGGAPGASAAAHEADAHESAAREADALRLGSRTAWRDVGRTGVFALGRKTWSTS
AGDAGLFELHACEFGARARAGAVLGGAAREARGGEAADGCA
 
Nucleotide Sequence: 966 bp     [Download]
>gi|124381141|ref|NC_008835.1|:c1260170-1259205 Burkholderia mallei NCTC 10229 chromosome II, complete sequence
ATGACGACGCCTGCCTTCCCGGCGCCGCCCGGCGCACGCACGTCGGCCCGGCCGCACGATACGCCGCTCG
ACGCGCGGCTCGCGGCTGCGCAAGCCGCGGTGCGCGCCCGGCCCGTCGATGCGGCGAGCCGTTGGGCGCT
GTTTCAACTGCTCTGCGTGACGGGCCAGGGGGAACGCGCCGTCGGGCAGTTGCAGGCTTATGCGCGGTTC
GCCGCGCAGCACGCGCACATCGCGCACGCCTATCGCGACCTGATTCGCGCCGAGCGCTTTCACGCCCGCG
TGATGGCGGGCCAGGCGCGGCCGGGATTCGTATTCGATGCGCCGCCGTGGATCGACGATCTGCTGGAAGC
GTTGCGCGCGCAGGCGGCCGGCGCGCGCGACGAAGCCGACCGCGCGCGTTCGCGCGCGCTCGATCGCGCG
CCGTTCGTCGCGGGGCGCGGGCCGGATGCGCCGTTCGACTGGATCGCCGACAGCGATTCGCGATTCGGGC
CGGTCTGCGAAGTCGTGACCGCCGGGCATGATCGTTGGCTGCCGTTTTCGGATCTGGCCGGATGGCGGCT
CGCGCGCCCGGGCGTGCTGCTCGCTCTGGTCTGGGCGCCGTGCGTGCTCACGCTTGCCGACGGCAGTGTC
GCGCACGGCTTCATGCCAGCGCGTTACCCGGGCTCCGAACTGGCCGACGGGGGCGGCGCGCCGGGCGCCT
CAGCGGCCGCGCACGAGGCCGATGCGCACGAGAGCGCCGCGCGCGAGGCCGATGCGTTGCGGCTCGGCAG
CCGGACCGCATGGCGCGACGTCGGCCGCACCGGCGTGTTCGCGCTCGGCCGCAAGACCTGGTCGACGAGC
GCGGGCGACGCCGGCCTTTTCGAGCTGCACGCGTGTGAATTCGGCGCGCGCGCCCGTGCGGGCGCCGTGC
TCGGCGGCGCGGCGCGCGAAGCGCGCGGCGGGGAGGCGGCCGATGGATGCGCATGA
 Primer design