SecReT6
Protein ID: 124384906
SecReT6 ID176
T6SS typeN/A
Gene symbol-
Locus tagBMA10229_A1710
StrainBurkholderia mallei NCTC 10229
Repliconchromosome I [GenBank: NC_008836] [Browse all T6SS(s) in this replicon]
Location [Strand]1751068..1751550 [+]
Producthypothetical protein
NoteTssE
UniProt IDA2S6X1
KEGG IDbml:BMA10229_A1710
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.00E-22, Aligned region: 29..137
Protein Sequence: 160 a.a.     [Download]
>gi|124384906|ref|YP_001027690.1| hypothetical protein BMA10229_A1710 [Burkholderia mallei NCTC 10229]
MKRFEPSFLDKLFDDEPHVPAPAAMRQLSLEELKNTVARDVEAILNTRIALTEEDLAELPECQRSVLTYG
LNDFAGLSLASHYDRTFICKSIQQAIARHEPRLQQVQVAFELNEQSTNALYFAIQALLVVHPAEEPVTFD
AMLQPSTLQYSVTRSRAAKV
 
Nucleotide Sequence: 483 bp     [Download]
>gi|124383319|ref|NC_008836.1|:1751068-1751550 Burkholderia mallei NCTC 10229 chromosome I, complete sequence
ATGAAACGTTTCGAACCGAGCTTCCTCGACAAGCTGTTCGACGACGAACCGCACGTGCCGGCGCCCGCCG
CGATGCGGCAGTTGTCGTTGGAGGAGCTGAAGAACACGGTCGCGCGCGACGTCGAGGCGATCCTCAACAC
GCGCATCGCGCTGACCGAAGAAGATCTCGCCGAGCTGCCCGAATGCCAGCGCTCGGTGCTGACCTACGGG
CTGAACGATTTCGCCGGCCTGAGCCTCGCGAGCCACTACGATCGCACGTTCATCTGCAAATCGATTCAGC
AGGCGATCGCGCGGCACGAGCCGAGGCTGCAGCAGGTGCAGGTGGCGTTCGAGCTGAACGAGCAGTCGAC
GAACGCGCTCTATTTCGCGATCCAGGCGCTGCTCGTCGTGCATCCTGCCGAGGAACCGGTGACCTTCGAT
GCGATGCTGCAGCCGTCGACGTTGCAATATTCGGTGACGCGTTCGCGCGCCGCCAAGGTGTGA
 Primer design