SecReT6
Protein ID: 124385829
SecReT6 ID176
T6SS typeN/A
Gene symbol-
Locus tagBMA10229_A1711
StrainBurkholderia mallei NCTC 10229
Repliconchromosome I [GenBank: NC_008836] [Browse all T6SS(s) in this replicon]
Location [Strand]1751630..1753468 [+]
Producthypothetical protein
NoteTssF
UniProt IDA2S6X2
KEGG IDbml:BMA10229_A1711
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.20E-212, Aligned region: 4..611
Protein Sequence: 612 a.a.     [Download]
>gi|124385829|ref|YP_001027691.1| hypothetical protein BMA10229_A1711 [Burkholderia mallei NCTC 10229]
MEELLPYYERELSFLRRYSLEFANRYPKIAARLAQTGEQCEDPHVERMIESFALLGARINKKLDDEYPEF
TEALVDVLYPHYLRPFPSCSIAQFGAPHAFAELTEPRIVERGTELKSRAIRGVQCRFRTAYDVTLAPIRL
ADARYGSVAVAPAAARLPGNATGVISIAFESTSPQLDLAALKLGKLRAHLHGEQSFVAALADCLFAHALA
CYVEPDRGGRWIALGKTPFEHAGFDETDALIDYPARSHPAYRLLTEYFAFPDKFNFVDFDLGALARRAGP
CRQLTLHIALRDVRGDSHVARLLDLLSASHFRLFCTPVVNLFRQHGEPIRVDHRAVSYPVIGDARRAFAY
EVYSIDSVHLVRQRADRETLVEFRPFYSLHHGEAAQAGHYWFARRNDDVARKSPGYETEISVVDVDFEPG
APQTDTLSLDLTCTNRDLPAALATGLDGGDLFIDGGEQPGPIALLRRPTPSARFERGHAAHWRLVSHLAL
NHVSLAEEGLAALKEALVLYDLRRSAVSTRHIDGIVGIEQKSAVQWLPGKPFATFVRGVEIRLAIDDEHF
VGSSLATFVRMIDAFFGLYVHLNSFVQLIVVSRRTGEEIMRCKPRSGESILA
 
Nucleotide Sequence: 1839 bp     [Download]
>gi|124383319|ref|NC_008836.1|:1751630-1753468 Burkholderia mallei NCTC 10229 chromosome I, complete sequence
ATGGAAGAGTTGTTGCCGTATTACGAACGCGAACTGTCGTTTCTGCGGCGCTATTCGCTCGAATTCGCGA
ACCGTTACCCGAAGATCGCCGCGCGTCTCGCCCAGACGGGCGAGCAGTGCGAGGATCCGCACGTCGAGCG
GATGATCGAATCGTTCGCGCTGCTCGGCGCGCGGATCAACAAGAAGCTCGACGACGAATATCCCGAGTTC
ACCGAAGCGCTCGTCGACGTCCTCTACCCGCACTATCTGCGGCCGTTCCCGTCATGCTCGATCGCGCAGT
TCGGTGCGCCGCATGCGTTCGCGGAGCTCACCGAGCCGCGGATCGTCGAGCGCGGCACCGAGCTGAAGAG
CCGCGCGATTCGCGGCGTGCAGTGCCGGTTCCGCACCGCGTACGACGTGACGCTCGCGCCGATCCGGCTC
GCCGATGCGCGCTACGGATCGGTCGCGGTGGCGCCCGCCGCAGCAAGGCTGCCCGGCAACGCGACGGGCG
TGATCTCGATCGCGTTCGAATCGACGTCGCCGCAGCTCGATCTCGCCGCGCTGAAGCTCGGCAAGCTGCG
CGCGCATTTGCACGGCGAGCAATCGTTCGTCGCCGCGCTGGCCGATTGCCTGTTCGCGCACGCGCTCGCC
TGCTACGTCGAGCCCGATCGCGGCGGCCGCTGGATCGCGCTCGGCAAGACGCCGTTCGAGCACGCGGGCT
TCGACGAGACCGACGCGCTGATCGACTATCCGGCCCGTTCGCATCCGGCCTATCGGCTGCTGACCGAATA
CTTCGCATTCCCGGATAAATTCAACTTCGTCGATTTCGATCTGGGCGCGCTCGCGCGGCGCGCGGGGCCC
TGCCGGCAGCTGACGCTGCACATCGCGCTGCGCGACGTGCGCGGCGATTCGCATGTCGCGCGGCTGCTCG
ATCTGCTGAGCGCGAGCCATTTCCGGCTCTTCTGCACGCCGGTCGTGAACCTGTTCCGCCAGCACGGCGA
GCCGATTCGGGTCGACCACCGGGCGGTGTCGTACCCGGTGATCGGCGATGCGCGCCGCGCGTTCGCGTAC
GAGGTATATTCGATCGATTCGGTGCATCTCGTGCGGCAGCGCGCGGACCGCGAAACGCTCGTCGAATTCC
GGCCGTTCTATTCGCTGCATCACGGCGAAGCCGCGCAGGCCGGCCACTACTGGTTCGCGCGGCGCAACGA
CGACGTCGCGCGCAAGAGCCCCGGCTACGAGACCGAGATTTCGGTCGTCGACGTCGACTTCGAGCCGGGC
GCGCCGCAAACCGATACGTTGAGCCTCGATCTCACCTGTACGAACCGCGACCTGCCGGCTGCGCTCGCGA
CGGGGCTCGACGGCGGCGATCTCTTCATCGACGGCGGCGAGCAGCCCGGCCCGATCGCGCTATTGCGCCG
GCCGACGCCGAGCGCGCGCTTCGAGCGCGGCCACGCCGCGCACTGGCGCCTCGTGTCGCATCTCGCGCTC
AATCACGTGTCGCTTGCCGAAGAAGGGCTCGCCGCGCTGAAGGAAGCGCTCGTGCTGTACGATCTGAGGC
GCTCCGCGGTGTCGACGCGCCATATCGACGGGATCGTCGGCATCGAGCAGAAGAGCGCGGTGCAATGGCT
GCCGGGCAAGCCGTTCGCGACGTTCGTGCGCGGCGTCGAGATCCGGCTCGCGATCGACGACGAACATTTC
GTCGGCTCGAGCCTCGCGACGTTCGTGCGGATGATCGACGCGTTCTTCGGGCTGTACGTGCACCTCAACA
GCTTTGTTCAACTGATCGTCGTGTCCAGGCGCACCGGCGAGGAGATCATGCGATGCAAACCGCGCAGCGG
CGAATCGATCCTGGCGTAG
 Primer design