SecReT6
Protein ID: 124386056
SecReT6 ID176
T6SS typeN/A
Gene symbol-
Locus tagBMA10229_A1715
StrainBurkholderia mallei NCTC 10229
Repliconchromosome I [GenBank: NC_008836] [Browse all T6SS(s) in this replicon]
Location [Strand]1758645..1759577 [-]
ProductompA family protein
NoteTagL
UniProt IDA2S6X6, A2S6X6
KEGG IDbml:BMA10229_A1715
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 2.90E-25, Aligned region: 144..177
OmpA [PF00691], Evalue: 2.90E-25, Aligned region: 208..302
BON [PF04972], Evalue: 0.0031, Aligned region: 81..119
BON [PF04972], Evalue: 0.0031, Aligned region: 156..169
Protein Sequence: 310 a.a.     [Download]
>gi|124386056|ref|YP_001027695.1| ompA family protein [Burkholderia mallei NCTC 10229]
MTKPRLPLLRACRFALALAALALGGAARADNVGPATVTPIDAGGVPVKSVPLAAPVTAAPVAATAGAGAT
VSSPPPANATPGQVVAGGKVADEATKAAVLQRLRDTYGAANVVDQIEIGNVATPPNWSANVQKLIGPQLK
QISKGQLKIDGTQIDVKGEVHNEAQRQQLASDMANALNPTYTIKNGLRVSASEQGLLDQTLANRTIEFET
GSATLTPQGRAILDQMAGALAKMSSRTVEIIGHTDNSGNRTSNIALSQARADAVKGYLVTKGIASQQLTT
TGVGPDQPIAPNDSADGRARNRRIEFRAGQ
 
Nucleotide Sequence: 933 bp     [Download]
>gi|124383319|ref|NC_008836.1|:c1759577-1758645 Burkholderia mallei NCTC 10229 chromosome I, complete sequence
ATGACGAAGCCCCGCCTGCCCCTGCTGCGCGCCTGCCGCTTCGCGCTCGCGCTCGCCGCGCTCGCGCTCG
GCGGCGCCGCGCGCGCCGACAACGTCGGCCCCGCCACCGTCACGCCGATCGACGCAGGCGGCGTGCCCGT
GAAATCGGTGCCGCTCGCCGCGCCCGTGACGGCCGCGCCGGTCGCCGCGACGGCCGGCGCGGGCGCGACC
GTGTCGTCGCCGCCGCCCGCGAACGCGACGCCGGGCCAGGTCGTCGCCGGCGGCAAGGTCGCCGACGAAG
CGACGAAGGCCGCCGTGCTGCAGCGCCTGCGCGACACGTACGGCGCCGCGAACGTCGTCGACCAGATCGA
AATCGGCAACGTCGCGACGCCGCCGAACTGGTCCGCGAACGTCCAGAAGCTGATCGGCCCGCAACTGAAA
CAGATCAGCAAAGGACAGCTGAAGATCGACGGCACGCAGATCGACGTGAAGGGCGAAGTGCACAACGAGG
CGCAGCGCCAGCAGCTCGCGAGCGACATGGCGAACGCGCTGAATCCGACCTACACGATCAAGAACGGGCT
GCGCGTGAGCGCGTCCGAGCAGGGCCTGCTCGACCAGACGCTCGCGAACCGCACGATCGAATTCGAAACC
GGCAGCGCGACGCTCACGCCGCAAGGCCGCGCGATTCTCGACCAGATGGCGGGCGCGCTCGCGAAGATGT
CGAGCCGAACGGTCGAGATCATCGGGCACACCGACAACTCGGGCAACCGCACGTCGAACATCGCGCTCAG
CCAGGCGCGCGCGGACGCGGTCAAGGGATATCTGGTGACGAAGGGCATCGCGTCGCAGCAACTGACGACG
ACGGGCGTCGGCCCCGATCAGCCGATCGCGCCGAACGATTCGGCCGACGGGCGCGCGCGCAATCGCCGGA
TCGAATTCCGCGCGGGACAGTAA
 Primer design