SecReT6
Protein ID: 126440145
SecReT6 ID178
T6SS typei4b
Gene symbol-
Locus tagBURPS668_3625
StrainBurkholderia pseudomallei 668
Repliconchromosome I [GenBank: NC_009074] [Browse all T6SS(s) in this replicon]
Location [Strand]3546300..3550193 [+]
Producthypothetical protein
NoteTssM
UniProt IDA3NE59
KEGG IDbpd:BURPS668_3625
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.60E-71, Aligned region: 64..107
ImcF-related_N [PF14331], Evalue: 1.60E-71, Aligned region: 189..445
IcmF-related [PF06761], Evalue: 1.40E-53, Aligned region: 494..861
DUF1215 [PF06744], Evalue: 1.80E-28, Aligned region: 993..1108
Protein Sequence: 1297 a.a.     [Download]
>gi|126440145|ref|YP_001060630.1| hypothetical protein BURPS668_3625 [Burkholderia pseudomallei 668]
MQRFLNVLTHPRTLTIVGFAALAAVLFIAADALQIGLAWAAVALGVALALWLATKLWRRWRVRRANRQLG
DMLEQQAETGKMSAAVAEPAKRAELDVLRTRLADTVKTIKTSKIGQVSGGSALYELPWYIVIGNPAAGKS
SAVINSGLQFPFADKNSAVIHGIGGTRNCDWFFTTEGILLDTAGRYSVHEEDRSEWLGFLDLLKRYRPKA
PINGIIVTASIAELTGNRPEFAINLAKNLRQRVQELTEKLEVFAPVYVMFTKADLITGFTEFFSSNDRQE
YDRVWGATLPYEPDEKRDVVALFDQRFEELYDGLKEISVAQLSVSRGNKLSPGQLSFPLEFSTIKPALRS
FLATLFEDNPFQYKPIFRGFYFTSALQEGETNSAAAQRIAHRFGLDSQSLPKPHSAFSKNGFFLRDLFSK
VIFADRQTVRQFASPTKTRVRYATFFGFVAALALALGGWTWSTIGNQQLVSNVQADLDNVTRLQQNRNDL
QSRLQAMDILEDRIEQLEQFRRDKPLSVSLGLYQGNRLEQHLLTEYYNGVRQILLAPVSDNLASFLKDVN
AHPDQLAPMTRAPESGATPAGPMPVSTHPAAPGAAPSPVVAQGRQQGGLYNDASPTNVEDAYNALKTYLM
LSDKRHVEQAHLTDQVARFWRGWLETNRGNMPRDEMIKSAERMITFYLSRVSDNDWPMIEANLALVDQTR
ENLRRVVRGMPARQRVYEEIKARASTRFAPMTIARIVGEGNTGLVAGSYAIPGTFTRDAWFQYVQPAIRD
AATKELQAKDWVLNTASADDLTLEGSPEQIQKTLVAMYKTEYAQHWQKFMQGIAVQGFGNFTQAVDAMNK
LGDPQDSPIRKVLETAYDQTSWDNPSLANATIKKAQTGVVNWVKQWFTRQPGGQIAANVDINGNPADVPM
GPIGQEFVGLGRIVATHDGTSMLKGYMDTLSKVRTRFNVIKNQGDPGPGARQLMQQTLDGNGSELADSLK
FVDEQMLTGLTDSQRKSLRPLLVRPLMQAFAVVIQPASVEVNKVWNAQVYQPFQNSLANKYPFAAGAKVE
AGAGEIAQVFGPDGSIAKFVGTTLGPLAVRRGDTLSARTWGDMGLALTPDFTGGFARWVAPLAGGAATSA
AASSEPQTVFQVLPQPSSGTTEYTIAIDGQQLRYRNTPPQWTNFVWPNPQGSPGATLSATTFDGRTLQLV
NEPGRYGLEKLINSAQRKRRPDGTFDLTWTQGSVSVSVTMRIISTSQPTGGGDQPQQQSLRGLRLPSSVA
DASAGGAANATAQPGSGAAAPQVAATAASASNAQGAQ
 
Nucleotide Sequence: 3894 bp     [Download]
>gi|126438353|ref|NC_009074.1|:3546300-3550193 Burkholderia pseudomallei 668 chromosome I, complete sequence
ATGCAACGCTTCCTCAACGTGTTGACTCACCCTCGCACGCTCACGATCGTCGGCTTCGCCGCGCTCGCGG
CGGTTCTGTTCATCGCGGCCGACGCGCTCCAGATCGGCCTCGCATGGGCGGCCGTCGCGCTCGGTGTCGC
GCTCGCGCTCTGGCTCGCGACGAAGCTCTGGCGCCGCTGGCGCGTGCGCCGCGCGAACCGCCAGCTCGGC
GACATGCTCGAGCAGCAGGCCGAAACGGGCAAGATGTCCGCCGCCGTGGCCGAGCCCGCGAAGCGCGCGG
AGCTCGACGTGCTGCGCACCCGCCTCGCCGACACGGTGAAGACGATCAAGACTTCGAAAATCGGCCAGGT
GTCGGGCGGCTCCGCGCTGTACGAACTGCCGTGGTACATCGTGATCGGCAATCCGGCCGCGGGCAAGAGC
AGCGCCGTCATCAACTCGGGGTTGCAGTTTCCGTTCGCGGACAAGAACAGCGCGGTGATCCACGGCATCG
GCGGCACGCGCAACTGCGACTGGTTCTTCACGACCGAAGGCATCCTGCTCGACACCGCGGGCCGCTATTC
GGTGCACGAGGAAGACCGCAGCGAATGGCTCGGCTTTCTCGATCTGCTCAAGCGCTATCGCCCGAAGGCC
CCGATCAACGGCATCATCGTGACGGCGAGCATCGCCGAGCTCACCGGCAATCGCCCCGAATTCGCGATCA
ACCTCGCGAAGAACCTGCGCCAGCGCGTGCAGGAGCTCACCGAGAAGCTCGAAGTGTTCGCGCCCGTCTA
CGTGATGTTCACGAAGGCCGACCTGATCACGGGCTTCACCGAATTCTTCAGCAGCAACGATCGCCAGGAA
TACGACCGCGTATGGGGCGCGACGCTGCCGTACGAGCCTGACGAGAAGCGCGACGTGGTCGCGCTGTTCG
ATCAGCGCTTCGAGGAACTGTATGACGGGCTCAAGGAAATCAGCGTCGCGCAGCTGTCGGTGAGCCGCGG
CAACAAGCTCTCGCCCGGCCAGTTGAGCTTCCCGCTCGAATTCTCGACGATCAAGCCCGCGCTGCGCTCG
TTCCTCGCGACGCTGTTCGAGGACAACCCGTTCCAGTACAAGCCGATCTTCCGCGGCTTCTACTTCACGA
GCGCGCTGCAGGAAGGCGAAACGAACAGCGCGGCCGCGCAGCGGATCGCGCACCGCTTCGGGCTCGATTC
GCAAAGCCTGCCGAAGCCGCACAGCGCGTTCTCGAAGAACGGCTTCTTCCTGCGCGACCTGTTTTCGAAG
GTGATCTTCGCCGATCGCCAGACGGTCCGCCAGTTCGCGAGCCCGACGAAGACGCGCGTGCGCTACGCGA
CGTTCTTCGGCTTCGTCGCGGCGCTCGCGCTCGCGCTCGGCGGCTGGACCTGGTCGACGATCGGCAACCA
GCAACTCGTCTCGAACGTGCAGGCCGACCTCGACAACGTGACCCGCCTGCAGCAGAACCGCAACGATCTG
CAATCTCGCCTGCAGGCGATGGACATCCTCGAGGATCGGATCGAGCAGCTCGAGCAGTTCCGGCGCGACA
AGCCGCTGTCCGTCTCGCTCGGCCTGTATCAGGGCAATCGGCTCGAGCAGCACCTGTTGACCGAGTACTA
CAACGGCGTGCGGCAGATCCTGCTCGCTCCCGTGTCGGACAATCTCGCGTCGTTCCTGAAGGACGTGAAC
GCGCATCCGGACCAGCTCGCGCCGATGACGCGCGCGCCCGAATCGGGCGCGACGCCGGCCGGCCCGATGC
CGGTATCGACCCATCCCGCGGCGCCGGGCGCGGCCCCCTCCCCCGTCGTCGCGCAGGGCCGGCAGCAGGG
CGGCCTCTATAACGACGCGTCGCCGACCAACGTCGAGGACGCGTACAACGCGCTGAAGACCTACCTGATG
CTCTCCGACAAGCGGCACGTCGAGCAGGCGCACCTGACCGATCAGGTCGCGCGCTTCTGGCGCGGCTGGC
TCGAGACGAATCGCGGCAACATGCCGCGCGACGAGATGATCAAGAGCGCGGAGCGAATGATCACGTTCTA
CCTGTCGCGTGTGTCCGACAACGACTGGCCGATGATCGAGGCGAATCTCGCGCTCGTCGACCAGACCCGC
GAGAACCTGCGCCGCGTCGTGCGCGGCATGCCGGCCCGCCAGCGCGTGTATGAAGAGATCAAGGCGCGCG
CGTCGACCCGCTTCGCGCCGATGACGATCGCGCGCATCGTCGGCGAAGGCAACACCGGCCTCGTCGCGGG
CAGCTACGCGATCCCCGGCACGTTCACGCGCGACGCGTGGTTCCAGTACGTGCAGCCGGCGATCCGCGAC
GCCGCGACGAAGGAGCTGCAGGCGAAGGATTGGGTGCTGAACACCGCGTCGGCGGACGATCTGACGCTCG
AGGGCAGCCCCGAGCAGATCCAGAAGACGCTCGTCGCGATGTACAAGACCGAGTACGCACAGCACTGGCA
GAAGTTCATGCAGGGCATCGCGGTGCAGGGCTTCGGCAATTTCACGCAGGCGGTCGACGCGATGAACAAG
CTCGGCGATCCGCAGGATTCGCCGATCCGCAAGGTGCTCGAGACCGCGTACGACCAGACCTCGTGGGACA
ACCCGTCGCTCGCGAACGCGACGATCAAGAAGGCGCAGACGGGCGTCGTGAACTGGGTCAAGCAGTGGTT
CACGCGCCAGCCGGGCGGCCAGATCGCGGCGAACGTCGACATCAACGGCAATCCCGCCGACGTGCCGATG
GGCCCGATCGGCCAGGAGTTCGTCGGGCTCGGCCGGATCGTCGCCACGCACGACGGCACGTCGATGCTCA
AGGGCTACATGGACACGCTGTCGAAGGTCCGCACGCGCTTTAACGTGATCAAGAACCAGGGCGACCCCGG
CCCCGGCGCGCGTCAGCTGATGCAGCAGACGCTCGACGGCAACGGCTCGGAGCTCGCCGATTCGCTGAAG
TTCGTCGACGAGCAGATGCTCACGGGCTTGACCGATTCGCAACGCAAATCGCTGCGCCCGCTTCTCGTGC
GCCCGCTGATGCAGGCGTTCGCGGTCGTGATCCAGCCGGCGAGCGTCGAGGTGAACAAGGTATGGAACGC
GCAGGTGTACCAGCCGTTCCAGAACTCGCTCGCGAACAAGTATCCGTTCGCGGCGGGCGCGAAGGTCGAG
GCGGGCGCGGGCGAGATCGCGCAGGTGTTCGGCCCCGACGGCTCGATCGCGAAGTTCGTCGGCACGACGC
TCGGCCCGCTCGCGGTGCGCCGCGGCGACACGCTGTCCGCGCGCACCTGGGGCGACATGGGCCTCGCGCT
CACGCCGGACTTCACGGGCGGCTTCGCGCGCTGGGTCGCGCCGCTCGCGGGCGGCGCGGCGACGAGCGCG
GCCGCGTCGTCCGAGCCGCAGACCGTGTTCCAGGTGCTGCCGCAGCCGAGCAGCGGCACGACCGAATACA
CGATCGCGATCGACGGCCAGCAGTTGCGCTACCGCAACACGCCGCCGCAATGGACGAACTTCGTGTGGCC
GAACCCGCAGGGCTCGCCCGGCGCGACGCTGTCCGCGACGACCTTCGACGGCCGCACGTTGCAGCTCGTC
AACGAGCCGGGCCGCTACGGCCTCGAGAAGCTGATCAACTCGGCGCAGCGCAAGCGCCGTCCGGACGGCA
CGTTCGATCTGACATGGACGCAGGGCAGCGTCAGCGTCTCTGTGACGATGCGCATCATCAGCACCTCGCA
GCCGACGGGCGGCGGCGATCAGCCGCAGCAGCAAAGCCTGCGCGGCCTGCGCCTGCCTTCGTCGGTCGCC
GACGCGAGCGCGGGCGGCGCGGCCAATGCGACGGCGCAACCCGGCTCGGGCGCCGCGGCCCCGCAGGTCG
CCGCCACGGCCGCTTCCGCATCGAACGCACAGGGGGCGCAATGA
 Primer design