SecReT6
Protein ID: 126443652
SecReT6 ID180
T6SS typei3
Gene symbol-
Locus tagBURPS668_A0327
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]290104..294180 [-]
ProductImcF/SciS family protein
NoteTssM
UniProt IDA3NG62
KEGG IDbpd:BURPS668_A0327
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.50E-97, Aligned region: 632..952
ImcF-related_N [PF14331], Evalue: 4.60E-93, Aligned region: 313..585
DUF1215 [PF06744], Evalue: 1.20E-35, Aligned region: 951..979
DUF1215 [PF06744], Evalue: 1.20E-35, Aligned region: 1060..1184
Protein Sequence: 1358 a.a.     [Download]
>gi|126443652|ref|YP_001061333.1| ImcF/SciS family protein [Burkholderia pseudomallei 668]
MNKVLSFLVSRSFIAFVALLAVALVIWFVGPFVAFGGLTPLAGAGMRVLAIALLLAGVLLWLAGRPTSIV
FVALLCVLIWHASPLLAFGGATPFAPEAVRAIAIALVLAAFALHLAFRLLQKARTDPDFLKSLLEFGGKQ
PESPAAGRLVAVNAAIAGAIARLKGMRSGARGLRRLLRGKRYLYELPWYVTLGSRACGKTSALLNAGLSF
PVAAQMPRAAAGLPDHGGSVDWWLTNDAVLIDTAGHYTRHGTSAHAAPLPPAGPAPHAQPADAAADARRA
NGQPAGERHAVAMAAAAPSSAAFVDERQAQWRQTVDQAEWLGFLRTLRKHRPREPINGALLAVDVATLTS
ADDNARHAEAAALRARLADLRAQLGVRFPVYLIVTKTDQLPGFAEYFSALTTEGRAQTWGFTLPYDKETI
ADEGVHARCADELRALAARLAAGVNTRLQEEHDTQRRRRLAALPEEFLVLTRPLGELIDRVFADSRYDDT
QHHATLRGVYFTSAAQTGGEAAAETRTVARRLAAATGRAPAAAARAAQQETSQSFFLHDLLTKIVIPDAR
LVQPNLRWEYRSRTLSLAAHALALLLFAWVAIGLRVSMGNNDAYLDALARKTAALASRVDQLYKAPKPEA
VPDVLTQARSLSAYPGLDLSAPGSGWRFGLYTPPGIVAESSRTYDALEDTLLLPRIVTRIEAVLSQAIAD
RDPKAAYDALRVYLMLYDRARFDAAQVEAWVLDDWARTDSAAVFGGRASMIAHVEQLFRGERIVQSPLIR
NDALIRQARAFLDGSNATERLYERAKAAMNKEAPDEFTLLRAVGPQAGTVFTRASGAPLARGVPGLFTFD
GYRRVFDKRLAEFVRTAREDDAWVMGRAYLGDAQKKTAEIANALAGADDPLTDAIRRQYLIEYAQQWDAF
LGDIRTIGGTSLAFDLVVLRSFAAPDSPLERLARAAVHETTLAQPEASADRSFLQKASAQLSQQADKALG
VRAQERVERELVDNRFAGLREMVTGRADTQTDARPGAPAGKSGLDAVANLLNDYYTALTVSDDALANNSM
PPANDTAAKLKMAAQTMPAPFRSVLTGLAAQGSREVNRGIGQLLSRQLQATVGDVCRLAIEGNYPFAPDS
KRDVGIEDFTRVFAQGGVIDDFFAKTLAPFVDTSTRPWRYKTLPGATEPVEGPDLEPFQHAKAIREVFFG
APGQKQMAWKADIRIPELDPTITSLAIDVDGQTALYQHGPVAPFAVSWPGPRGGVHAEITASPRIRPDTS
AVSTDGPWALLRLLQKGRVSGTATPGRTRVTLDFDGRKAVLDLASTGSVANPLTSDVLKTFRCPGSMPMF
SLADTGAPPGLPPGSPAAPTSRVARDGR
 
Nucleotide Sequence: 4077 bp     [Download]
>gi|126442307|ref|NC_009075.1|:c294180-290104 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGAACAAGGTCCTGTCCTTTCTGGTGTCTCGATCGTTCATCGCGTTCGTCGCGCTGCTCGCCGTCGCGC
TCGTCATCTGGTTCGTCGGCCCGTTCGTCGCGTTCGGCGGGCTCACGCCGCTCGCGGGCGCGGGCATGCG
CGTCCTCGCGATCGCGCTGCTGCTGGCGGGCGTGCTGCTGTGGCTCGCGGGCCGGCCGACGAGCATCGTG
TTCGTCGCGCTGCTGTGCGTGCTGATCTGGCATGCGTCGCCGCTGCTCGCGTTCGGCGGCGCGACGCCGT
TCGCGCCGGAGGCGGTCCGGGCGATCGCGATCGCGCTCGTGCTCGCGGCGTTCGCGCTGCACCTTGCGTT
CCGGCTGCTGCAAAAGGCGCGCACCGATCCGGATTTTCTGAAGAGCCTGCTCGAATTCGGCGGCAAGCAG
CCCGAATCGCCCGCGGCCGGCCGCCTGGTGGCGGTCAACGCCGCGATCGCCGGCGCGATCGCGCGCCTGA
AAGGCATGCGCAGCGGCGCGCGCGGCCTGCGCCGCCTGTTGCGCGGCAAGCGCTATCTGTACGAACTGCC
GTGGTACGTCACGCTCGGCTCGCGGGCATGCGGCAAGACGAGTGCGCTCCTGAACGCCGGGCTCTCGTTT
CCGGTCGCGGCGCAAATGCCGCGCGCGGCAGCCGGGCTGCCGGATCACGGCGGCTCGGTCGACTGGTGGT
TGACCAACGATGCGGTGCTGATCGACACGGCCGGCCATTACACGCGTCACGGCACGTCGGCGCACGCGGC
GCCGCTGCCGCCCGCCGGGCCCGCGCCGCACGCCCAGCCCGCCGACGCGGCCGCCGACGCGCGCCGCGCG
AACGGTCAGCCGGCGGGCGAGCGGCACGCCGTCGCGATGGCCGCGGCGGCGCCGTCGAGCGCCGCGTTCG
TCGACGAGCGGCAGGCGCAATGGCGGCAGACCGTCGACCAGGCCGAATGGCTGGGCTTTCTGCGGACGCT
GCGCAAGCATCGGCCGCGCGAGCCGATCAACGGCGCGCTGCTCGCCGTCGACGTCGCCACGCTCACGAGC
GCCGACGACAATGCGCGCCATGCCGAGGCAGCCGCGCTGCGCGCGCGGCTCGCCGATCTGCGCGCGCAAC
TGGGCGTGCGCTTTCCCGTCTATCTGATCGTCACGAAGACGGACCAGTTGCCGGGCTTCGCCGAATACTT
CAGCGCGCTGACCACGGAGGGCCGCGCGCAGACGTGGGGGTTCACGCTGCCGTACGACAAGGAGACCATC
GCGGACGAAGGCGTCCACGCGCGCTGCGCCGACGAGCTGCGCGCGTTGGCCGCGCGGCTCGCCGCGGGCG
TGAACACCCGCCTGCAGGAAGAGCACGACACGCAGCGGCGCCGCCGGCTCGCCGCGCTGCCGGAGGAATT
TCTCGTGCTGACACGCCCGCTCGGCGAGCTGATCGATCGCGTCTTCGCCGATTCCCGCTACGACGACACG
CAGCATCACGCGACGCTGCGCGGCGTGTATTTCACGAGCGCCGCGCAGACGGGCGGCGAGGCCGCCGCCG
AAACGCGCACCGTCGCGCGACGCCTCGCCGCCGCGACGGGCCGCGCGCCGGCCGCGGCCGCGCGCGCGGC
GCAGCAGGAAACCAGCCAGAGCTTCTTCCTGCACGATCTGCTGACGAAGATCGTCATTCCGGACGCACGC
CTCGTCCAGCCGAACCTTCGCTGGGAGTATCGCTCGCGCACGCTGAGCCTCGCCGCTCACGCGCTCGCGC
TGCTGCTGTTCGCGTGGGTCGCGATCGGCCTGCGCGTCAGCATGGGCAACAACGATGCCTATCTCGACGC
GCTCGCGCGCAAGACGGCGGCGCTCGCCTCCAGGGTCGACCAGTTGTACAAGGCGCCGAAGCCCGAGGCC
GTGCCCGACGTGCTGACGCAAGCCCGCTCGCTGAGCGCGTACCCGGGCCTCGATCTGTCCGCGCCGGGCA
GCGGCTGGCGGTTCGGCCTGTACACGCCGCCCGGCATCGTCGCCGAAAGCAGCCGCACGTACGACGCGCT
CGAGGACACCCTGCTGCTGCCGCGGATCGTCACGCGCATCGAGGCGGTGCTGTCGCAGGCGATCGCCGAT
CGCGATCCGAAGGCCGCGTACGACGCGCTGCGCGTCTATCTGATGCTGTACGACCGGGCCCGCTTCGATG
CCGCGCAGGTCGAGGCGTGGGTGCTCGACGACTGGGCGCGAACCGACAGCGCGGCGGTCTTCGGCGGCCG
CGCGTCGATGATCGCGCACGTCGAGCAACTGTTCCGCGGCGAGCGCATCGTGCAATCCCCGCTGATCCGC
AACGATGCGCTGATCCGCCAGGCGCGCGCGTTCCTGGACGGCAGCAACGCGACCGAGCGGCTCTACGAGC
GCGCGAAGGCGGCGATGAATAAAGAAGCGCCCGACGAGTTCACGCTGCTGCGGGCCGTCGGCCCGCAGGC
CGGCACGGTGTTCACGCGCGCGAGCGGCGCGCCGCTCGCGCGGGGCGTGCCGGGCCTCTTCACGTTCGAC
GGATACCGGCGCGTGTTCGACAAGCGGCTCGCCGAATTCGTGCGGACCGCGCGCGAAGACGACGCATGGG
TGATGGGCCGCGCGTATCTCGGCGACGCTCAAAAAAAAACGGCTGAGATCGCGAATGCGCTCGCGGGGGC
CGACGATCCGCTGACCGACGCGATCCGCCGGCAATATCTGATCGAATACGCGCAGCAATGGGACGCGTTT
CTCGGCGACATCCGCACGATCGGCGGCACGAGCCTCGCATTCGATCTCGTGGTGCTGCGCAGCTTCGCGG
CGCCGGATTCGCCGCTCGAGCGGCTCGCGCGCGCGGCGGTTCACGAGACGACGCTCGCGCAGCCCGAAGC
GAGCGCCGATCGCTCGTTCCTGCAAAAGGCGTCCGCCCAGTTGAGCCAGCAGGCGGACAAGGCGCTCGGC
GTGCGCGCGCAGGAGCGCGTCGAGCGCGAGCTCGTCGACAATCGCTTCGCGGGCCTGCGCGAAATGGTGA
CGGGCCGCGCGGACACGCAAACGGACGCGCGCCCGGGCGCGCCGGCCGGCAAGAGCGGGCTCGATGCGGT
CGCGAACCTGCTGAACGACTACTACACGGCGCTGACCGTCTCGGACGACGCGCTCGCGAACAACAGCATG
CCGCCCGCGAACGATACCGCGGCGAAACTGAAGATGGCCGCGCAGACGATGCCCGCGCCGTTTCGCTCGG
TGCTGACCGGGCTCGCCGCGCAGGGCTCGCGCGAAGTGAACCGCGGCATCGGCCAGTTGCTGTCGCGGCA
GTTGCAGGCGACGGTAGGCGACGTTTGCCGCCTCGCGATCGAGGGCAACTATCCGTTCGCGCCCGACAGC
AAGCGCGACGTCGGCATCGAGGACTTCACGCGCGTGTTCGCGCAAGGCGGCGTGATCGACGACTTCTTCG
CGAAGACGCTCGCGCCGTTCGTCGACACGTCGACGCGGCCTTGGCGCTACAAGACGCTGCCCGGCGCGAC
CGAACCGGTGGAGGGCCCCGATCTCGAACCGTTTCAGCACGCGAAGGCGATTCGCGAAGTGTTTTTCGGC
GCGCCCGGCCAGAAGCAGATGGCGTGGAAGGCCGACATCCGGATTCCCGAACTGGACCCGACGATCACGA
GCCTCGCGATCGACGTCGACGGACAGACGGCGCTCTATCAGCACGGCCCCGTCGCGCCGTTCGCGGTGAG
CTGGCCGGGGCCGCGCGGCGGCGTGCACGCGGAGATCACCGCGAGCCCGCGCATCCGGCCGGACACGTCG
GCGGTGTCGACGGACGGCCCGTGGGCGCTGCTGCGCCTGCTTCAGAAGGGACGCGTGAGCGGCACGGCGA
CGCCCGGGCGCACGCGCGTCACGCTCGACTTCGACGGCCGCAAGGCGGTGCTCGACCTCGCGAGCACGGG
CAGCGTCGCGAATCCGCTGACGAGCGACGTGCTGAAGACGTTCCGGTGCCCGGGCTCGATGCCGATGTTC
AGTCTCGCGGACACCGGCGCGCCGCCGGGCTTGCCGCCCGGGAGCCCGGCGGCGCCGACGTCGCGCGTCG
CGCGCGACGGGCGGTGA
 Primer design