SecReT6
Protein ID: 126444486
SecReT6 ID182
T6SS typei1
Gene symbol-
Locus tagBURPS668_A2138
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]2078017..2082003 [+]
Producthypothetical protein
NoteTssM
UniProt IDA3NLB1
KEGG IDbpd:BURPS668_A2138
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.80E-48, Aligned region: 171..416
ImcF-related_N [PF14331], Evalue: 1.80E-48, Aligned region: 1087..1127
Protein Sequence: 1328 a.a.     [Download]
>gi|126444486|ref|YP_001063132.1| hypothetical protein BURPS668_A2138 [Burkholderia pseudomallei 668]
MMIARIAALLALAALSWASALYFDWPLWCAPAVFCAALAGWLLCRVARRALRAVRARAQLARLDASERLP
AADAPELRVAARWRTALAALGRAQPAPRLRGRPRDALPWYLVIGPEGAGKTTALARARLVSPLRHARDDA
AIAPTEDCDWWCFDDAVVLDLAGRFAAPGATDDDRRAWHALLEQLGRARARRGVNGVVVAIDAPRLIEAS
RDALTIEGSAIRERLEQLIRLFDRRFPVYVLVTQCDRLYGFDEWAAQLAPEQRERAFGYLGDHDADAFVA
HALDSLDARLGALRVALAARGEPPSPRALMLPHELACLRPALEAFARAAFGPNVYQETPYLRGLLFASGR
QAGGAPSLTLPDWLDAAPARTPGDAGLFLHDVFARVLPGERDAWLPVERPSRSRLVLRRLALAAWLLASV
AAGLLMSASFVGDMRTVELVRRDYPAHPRFTGEFAHDTATLARIGRVIADVERRDERRLVRPLAGATPVG
RLEAELKRRYVAHYRRSIEPTADRLFFGEPDGASDVRAADDARLAARIRNLVRYVNLMQARRRGADRETL
AQMPAPAVARATDGGGARGVDSVGVSGVSGVSGVSGVSGVSGGVGGVGGVGGARAAEGAGRAVRASGGRR
AGGARAARGMRGAAGNAGAGAEIAPAADGVRDRDEGFARVSALAVDLIAWSAPDDRALAARVAAAQAELE
RLAYRDPDGAWLLALPDASMPRDVTLADFWPAAEPRTLPDAQPAALRDVRVPAALTAAHRPAIDAFLDEM
AQAVANRPKFAFHRDAFDTWYRARRIDAWRDFVARFPQGEQGLTTQAQWRAVIDRIADRRDPFAALLARV
DREFESERDDTLPPWLRFVRTTSHMLAPAMLAPARLPAASGGLGAALGSISRSGGRALREALGGAPEQGR
LTLERDAALRDALVDYERRVAALAADALAGPGAAYRLAADFHGFGVDPSVQASAMRAADSALRDVKRLAG
DRDVGGDVVWSLVGGPLRALIAYVERQASCALQDDWERDVLWPLRRAATRDDVEGLLYGPQGAIWAFVDG
PAKPFVRVGAARASALDTLGYRLPFTDAFLPLIDDAAARRVAQAQRDAERRAQQQAALELDERIASLGKQ
IDALRAQTVRFGIVAQPTDVNPDAQAKPFETVLTLQCAPQARTLTNYNLRVSEQIDWQPDRCGDATLRIS
LGGVTLVRRYAGSLGVARFVQDFRYGVRRFTPRDFPDAKAQLQRLGVRHIDVRYDFSGHDALLAHVGRID
ALERARRDDLARQRRAANRQDDDAGGATAIARAAASVANAPGAALPRRIGVCWGDPAHDRPDGDGAQP
 
Nucleotide Sequence: 3987 bp     [Download]
>gi|126442307|ref|NC_009075.1|:2078017-2082003 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGATGATCGCGCGGATCGCCGCGCTGCTCGCGCTCGCCGCGCTCAGTTGGGCGAGCGCGCTCTATTTCG
ACTGGCCGCTCTGGTGCGCGCCCGCCGTGTTCTGCGCGGCGCTCGCCGGATGGCTGCTGTGCCGCGTCGC
GCGCCGCGCGCTGCGCGCGGTTCGTGCGCGCGCGCAGCTCGCACGGCTCGACGCATCCGAGCGCCTGCCC
GCGGCCGACGCGCCGGAGCTGCGCGTCGCCGCGCGCTGGCGCACCGCGCTCGCCGCGCTCGGGCGCGCGC
AGCCCGCGCCGCGCCTGCGCGGCCGGCCGCGCGACGCGCTGCCGTGGTATCTCGTGATCGGCCCCGAGGG
CGCGGGCAAGACAACCGCGCTCGCGCGCGCGCGCCTCGTGTCGCCGCTGCGGCACGCGCGCGACGACGCG
GCCATCGCGCCGACCGAGGACTGCGACTGGTGGTGCTTCGACGACGCGGTCGTGCTCGATCTCGCGGGCC
GCTTCGCCGCGCCCGGCGCGACCGACGACGATCGCCGCGCATGGCACGCGCTCCTCGAGCAGCTCGGCCG
CGCGCGTGCGCGCCGGGGCGTGAACGGCGTCGTGGTCGCGATCGACGCGCCGCGCCTCATCGAAGCGAGC
CGCGATGCGCTGACGATCGAAGGCAGCGCCATTCGCGAACGGCTCGAGCAACTGATCCGCCTGTTCGACC
GGCGCTTTCCGGTGTACGTGCTCGTCACGCAATGCGACCGGCTCTACGGCTTCGACGAATGGGCCGCGCA
GCTCGCGCCGGAACAACGCGAGCGCGCGTTCGGCTATCTCGGCGATCACGACGCGGATGCGTTCGTCGCG
CACGCGCTCGACAGCCTCGACGCACGGCTCGGCGCGCTGCGCGTCGCGCTGGCGGCGCGCGGCGAGCCGC
CGTCGCCGCGCGCGCTGATGCTGCCGCACGAACTCGCGTGCCTGCGGCCCGCGCTCGAGGCGTTCGCACG
CGCGGCGTTCGGCCCGAACGTCTATCAGGAAACACCGTATCTGCGCGGGCTGCTGTTCGCGAGCGGCCGG
CAGGCGGGCGGCGCGCCGTCGCTGACGCTGCCCGACTGGCTCGACGCCGCGCCGGCGCGCACGCCCGGCG
ATGCGGGCCTGTTCCTGCACGACGTGTTCGCGCGCGTGCTGCCGGGCGAGCGCGACGCGTGGCTGCCCGT
CGAGCGGCCGAGCCGCTCGCGGCTCGTGCTGCGGCGCCTCGCGCTCGCCGCGTGGCTCCTCGCGAGCGTC
GCGGCCGGGCTGCTGATGAGCGCATCGTTCGTCGGCGACATGCGAACCGTCGAGCTGGTCCGCCGCGACT
ATCCCGCGCATCCGCGCTTCACCGGCGAATTCGCGCACGACACGGCGACGCTCGCGCGGATCGGCCGCGT
GATCGCCGACGTCGAGCGGCGCGACGAGCGGCGGCTCGTGCGCCCGCTCGCCGGCGCGACGCCCGTCGGC
CGGCTCGAAGCGGAACTCAAGCGCCGCTACGTCGCGCACTATCGGCGCTCGATCGAACCCACCGCCGATC
GGCTGTTCTTCGGCGAGCCGGACGGCGCGAGCGACGTGCGCGCGGCCGACGATGCGCGGCTCGCCGCGCG
CATCCGCAATCTGGTCCGCTACGTGAACCTGATGCAGGCGCGCCGGCGCGGCGCGGATCGCGAGACGCTC
GCGCAAATGCCCGCACCGGCGGTCGCGCGCGCGACGGATGGCGGTGGCGCTCGCGGAGTGGACAGTGTGG
GTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTCTGGCGGTGTAGGCGGTGT
AGGCGGTGTAGGCGGTGCGCGCGCCGCGGAAGGTGCGGGTCGCGCCGTCCGCGCGAGCGGCGGACGGCGC
GCAGGCGGTGCGCGCGCCGCGCGCGGCATGCGCGGCGCCGCCGGCAACGCCGGCGCCGGCGCTGAAATCG
CACCCGCCGCAGACGGCGTTCGCGATCGCGACGAAGGGTTCGCGCGCGTCAGCGCGCTCGCCGTCGACCT
GATCGCGTGGAGCGCGCCCGACGATCGCGCGCTCGCCGCGCGCGTCGCGGCCGCGCAGGCAGAGCTCGAA
CGGCTCGCGTACCGCGATCCGGACGGCGCGTGGCTGCTCGCGCTGCCGGATGCCTCGATGCCGCGCGACG
TGACGCTCGCCGATTTCTGGCCCGCCGCCGAGCCGCGCACGCTGCCCGACGCACAGCCCGCCGCGCTGCG
CGACGTGCGCGTGCCCGCCGCGCTGACGGCCGCGCATCGCCCGGCCATCGATGCGTTCCTCGACGAGATG
GCGCAGGCGGTCGCGAACCGGCCGAAGTTCGCGTTCCATCGCGACGCGTTCGACACGTGGTACCGCGCAC
GGCGCATCGACGCATGGCGCGACTTCGTCGCACGCTTCCCGCAGGGCGAGCAAGGGCTGACGACGCAAGC
GCAATGGCGCGCGGTGATCGACCGGATCGCCGATCGCCGCGATCCGTTCGCGGCATTGCTCGCGCGCGTC
GATCGCGAATTCGAATCCGAGCGCGACGACACGCTGCCGCCGTGGCTACGGTTCGTGCGCACGACATCGC
ACATGCTCGCCCCCGCGATGCTCGCGCCCGCACGCCTGCCCGCGGCGAGCGGCGGCCTGGGCGCCGCGCT
CGGCTCGATCTCGCGCAGCGGCGGACGCGCGCTGCGCGAAGCGCTCGGCGGCGCGCCCGAGCAAGGCAGG
CTCACGCTCGAGCGCGACGCCGCGCTGCGCGACGCGCTTGTCGACTACGAGCGGCGCGTCGCCGCACTCG
CCGCCGACGCGCTCGCGGGCCCCGGCGCCGCGTACCGGCTCGCGGCCGATTTCCACGGCTTCGGCGTCGA
TCCGTCCGTCCAGGCTTCCGCGATGCGCGCGGCCGACAGCGCGCTGCGCGACGTCAAGCGGCTCGCGGGC
GATCGCGACGTCGGCGGCGACGTCGTCTGGAGCCTCGTCGGCGGCCCGCTGCGCGCGCTGATCGCGTATG
TCGAGCGGCAGGCGTCGTGCGCGCTGCAAGACGACTGGGAGCGCGACGTGCTGTGGCCGCTCAGGCGCGC
GGCGACGCGCGACGACGTGGAGGGCCTGCTGTACGGCCCGCAAGGCGCGATCTGGGCGTTCGTCGACGGC
CCGGCGAAGCCGTTCGTGCGTGTCGGCGCGGCGCGTGCGTCGGCGCTCGACACGCTCGGCTACCGGCTGC
CGTTCACCGACGCGTTCCTGCCGCTCATCGACGACGCGGCCGCCCGGCGCGTCGCGCAAGCGCAGCGCGA
CGCCGAGCGGCGCGCGCAACAGCAGGCGGCGCTCGAGCTGGACGAGCGGATCGCATCGCTCGGCAAGCAG
ATCGACGCGCTGCGCGCGCAAACGGTGCGCTTCGGGATCGTCGCGCAGCCGACCGACGTGAACCCGGATG
CGCAGGCCAAGCCGTTCGAAACCGTGCTGACGCTGCAATGCGCGCCGCAGGCGCGCACGCTGACGAACTA
CAACCTGCGCGTGTCCGAGCAGATCGACTGGCAACCCGATCGATGCGGCGACGCGACGCTGCGCATCTCG
CTCGGCGGCGTCACGCTCGTGCGCCGTTACGCGGGATCGCTCGGCGTCGCGCGCTTCGTCCAGGACTTCC
GCTACGGCGTGCGCCGCTTCACGCCCCGCGATTTCCCGGACGCGAAAGCGCAGCTTCAACGTCTCGGCGT
GCGCCACATCGACGTGCGTTACGACTTCTCCGGGCATGACGCGCTGCTCGCGCACGTCGGTCGGATCGAC
GCGCTCGAACGCGCGCGCCGCGACGACCTCGCGCGGCAGCGGCGCGCCGCGAACCGGCAGGACGACGACG
CGGGCGGCGCGACGGCGATCGCGCGGGCGGCGGCGTCCGTCGCGAATGCGCCGGGCGCCGCGCTGCCCCG
CCGCATCGGCGTGTGTTGGGGGGACCCGGCGCACGACAGGCCCGATGGCGACGGCGCGCAACCGTGA
 Primer design