SecReT6
Protein ID: 126444923
SecReT6 ID181
T6SS typei3
Gene symbol-
Locus tagBURPS668_A0805
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]780332..783835 [+]
Producthypothetical protein
NoteTssM
UniProt IDA3NHI3
KEGG IDbpd:BURPS668_A0805
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.80E-69, Aligned region: 493..799
IcmF-related [PF06761], Evalue: 2.80E-69, Aligned region: 867..880
ImcF-related_N [PF14331], Evalue: 2.90E-29, Aligned region: 188..377
DUF1215 [PF06744], Evalue: 1.50E-27, Aligned region: 80..99
DUF1215 [PF06744], Evalue: 1.50E-27, Aligned region: 300..318
DUF1215 [PF06744], Evalue: 1.50E-27, Aligned region: 904..1029
Protein Sequence: 1167 a.a.     [Download]
>gi|126444923|ref|YP_001061804.1| hypothetical protein BURPS668_A0805 [Burkholderia pseudomallei 668]
MIRTSLRVFAAILIAILIWWVGPLFAFGIYHPLGPVWVREILVALVLIWGFWPTLARLWARLAMSPRQVK
VAPKAKQLDFVDKHLRTLDQQLKERWRKEPRGRWKRWVGALTREHRTMLPWYLVLGSEGSGKSSLVAKAV
SVSGSLQDRVLGSDATYGRGDDLNFRITREAVWFDVGGRWSLRAGADEAEFDAWRKLLRGMRRLRRGAPI
SGVVLCVDGLEMIDAPLDARKRLADSVRARLEEMREAFGQQVQVYVALNGLDRLDGAVSTLSLLEASKWV
KGVGFSLPDDGAHADAARADASWQHALQGLQQRVQQQVLYSAPAATEVSMNHAQLRFVETLSRLQKALVA
WLHVALAPGEPHTAARLRGVWLGSMAELAEPHPAGAGGVGSAELPVPSRPLSELWTPLIRQVALERDAVR
PSGPKSWRGRLGEALRWGAVPLVALSLLLWFGWGYVTERDYLDGVWAQFTEAKRLAQAEASYGNDGGSTL
IEIANQMRYAQLQAEDAAQGMATPYFEHGLVAETARETYYRHLQKMLMPELYNEVRRTLVSQVDGSPGDI
YQTLKVYLMLCRPARRSADDVVRWLDGRWDALSGGQYSDDDRRSLLAHVRTLMSLKEVPATPEDANLVRS
ARAKAAQIPLVTRVLQHIHAQGLPQQVNDISLSRAAGFEASMSLRMRSNVPSTDTAVSGWFTRAGYTDVF
LPRLQKSARAMLEEESWVLRDETLSGNSFQIDGLVQKLADSARNQFLQDYISAWQNFLNDVTVRGVTGLD
DASQLAAAMMEAQSPLANLLRFAARETTLTGASDEGNIDSWIDRQKYRFEKGRRQVVGELSGQHYRTVLL
PEHVVEEHFQAIRQLAAQLNRNNTIANNPLSRLFEPLYRQLGLVNGALQAGQVLPAQYDAFSRLKETAAR
QPEPVRGIMLDLVSSGSTMTTRESGALLNRGAAGATKMVCDQGFTGRYPMRRGAQADAGVEDFERLFSAQ
GLMATYFRDHLAAYVDTSAKPWQALRSNGGPNGMVSQSVLNSYETAERIRGAMLDDSGHLRVSTVLRFID
MDSQLSEAQLSVAGQTVRFAHGVTSPHRVDWTNQNTQLAIKLQLKSVDGRMTTLQFDGPWALFRFFDAGQ
AVGGTGTADRRERLYQTSLGTVRIEWQALTLPSPIWSGILQSFRCPS
 
Nucleotide Sequence: 3504 bp     [Download]
>gi|126442307|ref|NC_009075.1|:780332-783835 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGATCCGCACGAGCTTGAGAGTATTCGCGGCGATTCTGATCGCGATCCTGATCTGGTGGGTGGGGCCGC
TGTTCGCGTTCGGCATCTATCACCCGCTCGGCCCGGTGTGGGTGCGCGAGATCCTCGTCGCACTGGTGCT
GATCTGGGGCTTCTGGCCGACGCTCGCGCGGCTCTGGGCGCGGCTCGCGATGAGCCCGCGGCAGGTGAAG
GTCGCGCCGAAGGCCAAGCAGCTCGATTTCGTCGACAAGCATCTGCGCACCCTCGACCAGCAGTTGAAGG
AGCGCTGGCGCAAGGAGCCGCGCGGCCGCTGGAAGCGCTGGGTCGGCGCGCTCACGCGCGAGCATCGCAC
GATGCTGCCGTGGTATCTGGTGCTCGGCTCCGAGGGTAGCGGCAAGTCGAGCCTCGTCGCGAAGGCGGTG
AGCGTGTCCGGCTCGCTGCAGGACCGGGTGCTCGGCTCGGACGCGACCTACGGGCGCGGCGACGACTTGA
ACTTCCGCATCACGCGCGAGGCGGTGTGGTTCGACGTCGGCGGCCGCTGGAGCCTGCGCGCGGGCGCCGA
CGAGGCCGAGTTCGACGCGTGGCGCAAGCTGCTGCGCGGGATGAGGCGGCTGCGCAGGGGCGCGCCGATC
AGCGGCGTCGTGCTGTGCGTCGACGGCCTCGAGATGATCGATGCGCCGCTCGACGCGCGCAAGCGGCTGG
CCGATTCGGTGCGCGCGCGGCTCGAGGAGATGCGCGAGGCGTTCGGCCAGCAGGTGCAGGTGTACGTTGC
GCTGAACGGGCTCGACCGGCTCGACGGCGCGGTCTCGACGCTGTCGCTGCTCGAGGCGTCGAAGTGGGTC
AAGGGCGTGGGCTTCAGCCTGCCCGACGACGGCGCGCACGCCGACGCCGCGCGCGCGGACGCGAGCTGGC
AGCACGCGCTGCAAGGGCTGCAGCAGCGGGTCCAGCAGCAGGTGCTGTATTCGGCGCCGGCGGCGACCGA
GGTGTCGATGAACCACGCGCAGTTGCGCTTCGTCGAGACGCTCAGCCGCCTGCAGAAGGCGCTCGTCGCG
TGGCTGCACGTCGCGCTCGCGCCGGGCGAGCCGCACACGGCCGCGCGGCTGCGCGGGGTGTGGCTGGGCT
CGATGGCCGAGCTCGCGGAGCCGCATCCGGCGGGCGCGGGCGGCGTCGGCTCGGCGGAGCTGCCCGTGCC
GTCGCGCCCGCTCAGCGAGCTGTGGACGCCGCTCATCCGGCAGGTGGCGCTCGAGCGCGACGCGGTGCGC
CCGAGCGGGCCGAAGTCGTGGCGCGGGCGCCTGGGCGAGGCGCTGCGCTGGGGCGCGGTGCCCCTCGTCG
CGTTGAGCCTGCTGCTGTGGTTCGGCTGGGGCTACGTCACCGAGCGCGACTATCTGGACGGCGTCTGGGC
GCAGTTCACCGAGGCCAAGCGGCTCGCGCAGGCCGAGGCGTCCTACGGCAACGACGGCGGCTCGACGCTC
ATCGAGATCGCGAATCAGATGCGCTATGCGCAACTGCAGGCCGAGGACGCCGCGCAGGGCATGGCGACGC
CGTACTTCGAGCACGGGCTCGTCGCGGAGACCGCGCGCGAGACCTACTACCGGCACTTGCAGAAGATGCT
GATGCCGGAGCTGTACAACGAGGTGCGGCGCACGCTCGTGTCGCAGGTCGACGGCAGCCCGGGCGACATC
TACCAGACGCTGAAGGTCTACCTGATGCTCTGCCGCCCCGCGCGGCGCTCGGCGGACGACGTCGTGCGCT
GGCTCGACGGCCGCTGGGACGCGCTCTCGGGCGGGCAGTACTCGGACGACGACCGCCGCTCGCTGCTCGC
GCACGTGCGCACGCTGATGTCGCTGAAGGAGGTGCCGGCCACGCCGGAGGACGCGAACCTCGTGCGCTCG
GCGCGCGCGAAGGCCGCGCAGATCCCGCTCGTCACGCGCGTGCTGCAGCACATCCACGCGCAGGGGCTGC
CGCAGCAGGTCAACGACATCTCGCTGTCGCGCGCGGCGGGCTTCGAGGCGTCGATGAGCCTGCGCATGCG
CAGCAACGTGCCGTCGACCGACACCGCGGTGTCGGGCTGGTTCACGCGCGCGGGCTACACGGACGTGTTC
CTGCCGCGCCTGCAGAAGAGCGCGCGCGCGATGCTCGAGGAGGAGAGCTGGGTGCTGCGCGACGAGACGC
TGTCGGGCAACAGCTTCCAGATCGACGGACTCGTGCAGAAGCTCGCCGATTCGGCGCGCAACCAGTTCCT
GCAGGACTACATCTCCGCGTGGCAGAACTTCCTGAACGACGTGACGGTGCGCGGCGTGACGGGCCTGGAC
GATGCGTCGCAGCTCGCCGCGGCGATGATGGAGGCGCAATCGCCGCTCGCGAACCTGCTGCGCTTCGCCG
CGCGCGAGACGACGCTCACGGGCGCGAGCGACGAAGGCAACATCGACAGCTGGATCGATCGCCAGAAGTA
CCGCTTCGAGAAGGGGCGGCGGCAGGTCGTCGGCGAGCTGAGCGGGCAGCATTACCGCACGGTGCTGCTG
CCGGAGCACGTGGTCGAGGAGCACTTCCAGGCGATCCGCCAGCTCGCCGCGCAACTGAACCGCAACAACA
CGATCGCGAACAACCCGCTGTCGCGGCTGTTCGAGCCGCTGTACCGACAGCTCGGGCTCGTCAACGGCGC
GCTGCAGGCGGGCCAGGTGCTGCCCGCGCAGTACGACGCGTTCTCGCGGCTGAAGGAGACGGCCGCGCGC
CAGCCGGAGCCGGTGCGCGGGATCATGCTCGACCTCGTGAGCAGCGGCAGCACGATGACGACGCGCGAAT
CGGGCGCGCTGCTCAACCGGGGCGCGGCGGGCGCGACGAAGATGGTCTGCGATCAGGGCTTCACGGGCCG
CTATCCGATGCGCCGCGGCGCGCAGGCGGATGCGGGCGTGGAGGACTTCGAGCGGCTGTTCAGCGCGCAG
GGGCTGATGGCGACGTACTTCCGCGATCACCTCGCCGCGTATGTGGACACATCGGCCAAGCCGTGGCAGG
CGCTGCGCTCGAACGGCGGGCCGAACGGGATGGTGAGCCAGTCGGTGCTGAACTCGTACGAGACGGCCGA
GCGCATCCGCGGCGCGATGCTCGACGATTCGGGGCACCTGCGCGTGTCGACCGTGCTGCGTTTCATCGAC
ATGGATTCGCAGTTGTCCGAAGCGCAGCTGAGCGTGGCCGGGCAGACGGTGCGCTTCGCGCACGGCGTGA
CCTCGCCGCACCGGGTGGACTGGACCAACCAGAACACGCAGCTCGCGATCAAGCTGCAGCTCAAATCGGT
GGACGGCCGGATGACGACGCTGCAGTTCGACGGGCCGTGGGCGCTGTTCCGCTTCTTCGACGCGGGGCAG
GCGGTGGGCGGCACGGGCACCGCGGACCGGCGCGAGCGGCTGTATCAGACGAGCCTCGGCACGGTGCGCA
TCGAATGGCAGGCGCTCACGCTGCCGTCGCCGATATGGTCGGGCATCCTGCAGTCGTTCAGGTGTCCGTC
GTGA
 Primer design