SecReT6
Protein ID: 126446608
SecReT6 ID192
T6SS typei3
Gene symbol-
Locus tagBMA10247_A2019
StrainBurkholderia mallei NCTC 10247
Repliconchromosome II [GenBank: NC_009079] [Browse all T6SS(s) in this replicon]
Location [Strand]1951887..1952825 [-]
ProductImpA-related N-terminal family protein
NoteTssA
UniProt IDA3MG08
KEGG IDbmn:BMA10247_A2019
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.20E-16, Aligned region: 46..104
Protein Sequence: 312 a.a.     [Download]
>gi|126446608|ref|YP_001079194.1| ImpA-related N-terminal family protein [Burkholderia mallei NCTC 10247]
MNNDALPGHSPDLLDFDEDFIKIDAAICEYDSVGYAPQRKGESAFQWASIETGCLALLKKAKDVRVGIWH
LRACIARRGLSGLADGVRSLADLMSAPVEELHPRALPDESPGETLLIHLGWLAGPQFLHQLGSSRFEDRD
ATLNDLIGGRAAAIVEDRDYRLRANTLVHGIQDSLSRIRESIAAAEQELNVSRVLDLLSVAASRLTQAQA
GGADSASVESDAPVDAPAGASAPGAQQPMAGPGGVLRSRQEVGAALDRIVEYFRVHEPSHPAPIFLSRIQ
RMLGAGFEEVMAELYPEAASLVAQLSRPQSSK
 
Nucleotide Sequence: 939 bp     [Download]
>gi|126445587|ref|NC_009079.1|:c1952825-1951887 Burkholderia mallei NCTC 10247 chromosome II, complete sequence
ATGAACAACGATGCACTCCCGGGCCATTCGCCGGATTTGCTGGATTTCGACGAAGACTTTATCAAGATCG
ACGCAGCCATCTGCGAATACGATTCCGTCGGTTACGCGCCGCAACGCAAAGGAGAGAGTGCGTTCCAGTG
GGCGTCCATCGAAACGGGATGTCTCGCTTTGTTGAAGAAGGCGAAGGATGTCCGGGTCGGCATTTGGCAT
CTGCGCGCATGCATCGCGCGGCGCGGGCTGAGCGGGCTGGCAGACGGCGTTCGATCGCTGGCCGATCTGA
TGAGTGCGCCCGTCGAGGAATTGCATCCTCGCGCGCTGCCTGACGAATCGCCCGGCGAAACCCTCCTGAT
TCATCTCGGCTGGCTTGCGGGCCCGCAGTTTCTGCATCAGCTCGGCAGTTCCCGGTTCGAAGACCGGGAC
GCAACCCTCAACGATCTGATCGGCGGGCGCGCCGCGGCGATCGTGGAGGATCGCGACTATCGCCTTAGAG
CGAATACTCTTGTACATGGCATTCAGGATTCCTTATCGCGAATTCGGGAATCGATCGCCGCGGCCGAGCA
AGAGCTCAACGTCTCGCGCGTGCTCGACCTGTTGAGCGTCGCGGCGTCTCGGCTCACGCAGGCACAAGCC
GGCGGCGCGGACAGCGCAAGCGTCGAGAGCGACGCGCCGGTCGATGCGCCGGCCGGCGCGTCCGCGCCCG
GCGCGCAGCAGCCGATGGCGGGGCCGGGCGGCGTGTTGAGGTCGAGACAGGAGGTCGGCGCGGCGCTCGA
TCGGATCGTGGAGTACTTCCGCGTGCACGAACCGAGCCATCCGGCGCCGATCTTCCTGTCGCGGATTCAA
CGAATGCTGGGGGCGGGTTTCGAGGAAGTGATGGCGGAGCTCTATCCCGAGGCGGCATCTCTCGTGGCCC
AACTGAGCCGGCCGCAGAGTTCCAAGTAA
 Primer design