SecReT6
Protein ID: 126446755
SecReT6 ID192
T6SS typei3
Gene symbol-
Locus tagBMA10247_A2000
StrainBurkholderia mallei NCTC 10247
Repliconchromosome II [GenBank: NC_009079] [Browse all T6SS(s) in this replicon]
Location [Strand]1926550..1930053 [-]
Producthypothetical protein
NoteTssM
UniProt IDA3MFZ0
KEGG IDbmn:BMA10247_A2000
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.80E-69, Aligned region: 493..799
IcmF-related [PF06761], Evalue: 2.80E-69, Aligned region: 867..880
ImcF-related_N [PF14331], Evalue: 8.60E-29, Aligned region: 188..377
DUF1215 [PF06744], Evalue: 1.50E-27, Aligned region: 80..99
DUF1215 [PF06744], Evalue: 1.50E-27, Aligned region: 300..318
DUF1215 [PF06744], Evalue: 1.50E-27, Aligned region: 904..1029
Protein Sequence: 1167 a.a.     [Download]
>gi|126446755|ref|YP_001079176.1| hypothetical protein BMA10247_A2000 [Burkholderia mallei NCTC 10247]
MIRTSLRVFAAILIAILIWWVGPLFAFGIYHPLGPVWVREILVALVLIWGFWPTLARLWARLAMSPRQVK
VAPKAKQLDFVDKHLRTLDQQLKERWRKEPRGRWKRWVGALTREHRTMLPWYLVLGSEGSGKSSLVAKAV
SVSGSLQDRVLGSDATYGRGDDLNFRITREAVWFDVGGRWSLRAGADEAEFDAWRKLLRGMRRLRRGAPI
SGVVLCVDGLEMIDAPLDARKRLADSVRARLEEMREAFGQQVQVYVALNGLDRLDGAVSTLSLLEASKWV
KGVGFSLPDDGAHADAARADASWQHALQGLQQRVQQQVLYSAPAATEVSMNHAQLRFVETLSRLQKGLVA
WLHVALAPGEPHTAARLRGVWLGSMAELAEPHPAGAGGVGSAELPVPSRPLSELWTPLIRQVALERDAVR
PSGPKSWRGRLGEALRWGAVPLVALSLLLWFGWGYVTERDYLDGVWAQFTEAKRLAQAEASYGNDGGSTL
IEIANQMRYAQLQAEDAAQGMATPYFEHGLVAETARETYYRHLQKMLMPELYNEVRRTLVSQVDGSPGDI
YQTLKVYLMLCRPARRSADDVVRWLDGRWDALSGGQYSDDDRRSLLAHVRTLMSLKEVPATPEDANLVRS
ARAKAAQIPLVTRVLQHIHAQGLPQQVNDISLSRAAGFEASMSLRMRSNVPSTDTAVSGWFTRAGYTDVF
LPRLQKSARAMLEEESWVLRDETLSGNSFQIDGLVQKLADSARNQFLQDYISAWQNFLNDVTVRGVTGLD
DASQLAAAMMEAQSPLANLLRFAARETTLTGASDEGNIDSWIDRQKYRFEKGRRQVVGELSGQHYRTVLL
PEHVVEEHFQAIRQLAAQLNRNNTIANNPLSRLFEPLYRQLGLVNGALQAGQVLPAQYDAFSRLKETAAR
QPEPVRGIMLDLVSSGSTMTTRESGALLNRGAAGATKMVCDQGFTGRYPMRRGAQADAGVEDFERLFSAQ
GLMATYFRDHLAAYVDTSAKPWQALRSNGGPNGMVSQSVLNSYETAERIRGAMLDDSGHLRVSTVLRFID
MDSQLSEAQLSVAGQTVRFAHGVTSPHRVDWTNQNTQLAIKLQLKSVDGRMTTLQFDGPWALFRFFDAGQ
AVGGTGTADRRERLYQTSLGTVRIEWQALTLPSPIWSGILQSFRCPS
 
Nucleotide Sequence: 3504 bp     [Download]
>gi|126445587|ref|NC_009079.1|:c1930053-1926550 Burkholderia mallei NCTC 10247 chromosome II, complete sequence
ATGATCCGCACGAGCTTGAGAGTATTCGCGGCGATTCTGATCGCGATCCTGATCTGGTGGGTGGGGCCGC
TGTTCGCGTTCGGCATCTATCACCCGCTCGGCCCGGTGTGGGTGCGCGAGATCCTCGTCGCACTGGTGCT
GATCTGGGGCTTCTGGCCGACGCTCGCGCGGCTCTGGGCGCGGCTCGCGATGAGCCCGCGGCAGGTGAAG
GTCGCGCCGAAGGCCAAGCAGCTCGATTTCGTCGACAAGCATCTGCGCACCCTCGACCAGCAGTTGAAGG
AGCGCTGGCGCAAGGAGCCGCGCGGCCGCTGGAAGCGCTGGGTCGGCGCGCTCACGCGCGAGCATCGCAC
GATGCTGCCGTGGTATCTGGTGCTCGGCTCCGAGGGTAGCGGCAAGTCGAGCCTCGTCGCGAAGGCGGTG
AGCGTGTCCGGCTCGCTGCAGGACCGGGTGCTCGGCTCGGACGCGACCTACGGGCGCGGCGACGACTTGA
ACTTCCGCATCACGCGCGAGGCGGTGTGGTTCGACGTCGGCGGCCGCTGGAGCCTGCGCGCGGGTGCCGA
CGAGGCCGAGTTCGACGCGTGGCGCAAGCTGCTGCGCGGGATGAGGCGGCTGCGCAGGGGCGCGCCGATC
AGCGGCGTCGTGCTGTGCGTCGACGGCCTCGAGATGATCGATGCGCCGCTCGACGCGCGCAAGCGGCTGG
CCGATTCGGTGCGCGCGCGGCTCGAGGAGATGCGCGAGGCGTTCGGCCAGCAGGTGCAGGTGTACGTTGC
GCTGAACGGGCTCGACCGGCTCGACGGCGCGGTCTCGACGCTGTCGCTGCTCGAGGCGTCGAAGTGGGTC
AAGGGCGTGGGCTTCAGCCTGCCCGACGACGGCGCGCACGCCGACGCCGCGCGCGCGGACGCGAGCTGGC
AGCACGCGCTGCAAGGGCTGCAGCAGCGGGTCCAGCAGCAGGTGCTGTATTCGGCGCCGGCGGCGACCGA
GGTGTCGATGAACCACGCGCAGTTGCGCTTCGTCGAGACGCTCAGCCGCCTGCAGAAGGGGCTCGTCGCG
TGGCTGCACGTCGCGCTCGCGCCGGGCGAGCCGCACACGGCCGCGCGGCTGCGCGGGGTGTGGCTGGGCT
CGATGGCCGAGCTCGCGGAGCCGCATCCGGCGGGCGCGGGCGGCGTCGGCTCGGCGGAGCTGCCCGTGCC
GTCGCGCCCGCTCAGCGAGCTGTGGACGCCGCTCATCCGGCAGGTGGCGCTCGAGCGCGACGCGGTGCGC
CCGAGCGGGCCGAAGTCGTGGCGCGGGCGCCTGGGCGAGGCGCTGCGCTGGGGCGCGGTGCCCCTCGTCG
CGTTGAGCCTGCTGCTGTGGTTCGGCTGGGGCTACGTCACCGAGCGCGACTATCTGGACGGCGTCTGGGC
GCAGTTCACCGAGGCCAAGCGGCTCGCGCAGGCCGAGGCGTCCTACGGCAACGACGGCGGCTCGACGCTC
ATCGAGATCGCGAACCAGATGCGCTATGCGCAACTGCAGGCCGAGGACGCCGCGCAGGGCATGGCGACGC
CGTACTTCGAGCACGGGCTCGTCGCGGAGACCGCGCGCGAGACCTACTACCGGCACTTGCAGAAGATGCT
GATGCCGGAGTTGTACAACGAGGTGCGGCGCACGCTCGTGTCGCAGGTCGACGGCAGCCCGGGCGACATC
TACCAGACGCTGAAGGTCTACCTGATGCTCTGCCGCCCCGCGCGGCGCTCGGCGGACGACGTCGTGCGCT
GGCTCGACGGCCGCTGGGACGCGCTCTCGGGCGGGCAGTACTCGGACGACGACCGCCGCTCGCTGCTCGC
GCACGTGCGCACGCTGATGTCGCTGAAGGAGGTGCCGGCCACGCCGGAGGACGCGAACCTCGTGCGCTCG
GCGCGCGCGAAGGCCGCGCAGATCCCGCTCGTCACGCGCGTGCTGCAGCACATCCACGCGCAGGGGCTGC
CGCAGCAGGTCAACGACATCTCGCTGTCGCGCGCGGCGGGCTTCGAGGCGTCGATGAGCCTGCGCATGCG
CAGCAACGTGCCGTCGACCGACACCGCGGTGTCGGGCTGGTTCACGCGCGCGGGCTACACGGACGTGTTC
CTGCCGCGCCTGCAGAAGAGCGCGCGCGCGATGCTCGAGGAGGAGAGCTGGGTGCTGCGCGACGAGACGC
TGTCGGGCAACAGCTTCCAGATCGACGGACTCGTGCAGAAGCTCGCCGATTCGGCGCGCAACCAGTTCCT
GCAGGACTACATCTCCGCGTGGCAGAACTTCCTGAACGACGTGACGGTGCGCGGCGTGACGGGCCTGGAC
GATGCGTCGCAGCTCGCCGCGGCGATGATGGAGGCGCAATCGCCGCTCGCGAACCTGCTGCGCTTCGCCG
CGCGCGAGACGACGCTCACGGGCGCGAGCGACGAAGGCAACATCGACAGCTGGATCGATCGCCAGAAGTA
CCGCTTCGAGAAGGGGCGGCGGCAGGTCGTCGGCGAGCTGAGCGGGCAGCATTACCGCACGGTGCTGCTG
CCGGAGCACGTGGTCGAGGAGCACTTCCAGGCGATCCGCCAGCTCGCCGCGCAACTGAACCGCAACAACA
CGATCGCGAACAACCCGCTGTCGCGGCTGTTCGAGCCGCTGTACCGGCAGCTCGGGCTCGTCAACGGCGC
GCTGCAGGCGGGCCAGGTGCTGCCCGCGCAGTACGACGCGTTCTCGCGGCTGAAGGAGACGGCCGCGCGC
CAGCCGGAGCCGGTGCGCGGGATCATGCTCGACCTCGTGAGCAGCGGCAGCACGATGACGACGCGCGAAT
CGGGCGCGCTGCTCAACCGGGGCGCGGCGGGCGCGACGAAGATGGTCTGCGATCAGGGCTTCACGGGCCG
CTATCCGATGCGCCGCGGCGCGCAGGCGGATGCGGGCGTGGAGGACTTCGAGCGGCTGTTCAGCGCGCAG
GGGCTGATGGCGACGTACTTCCGCGATCACCTCGCCGCGTATGTGGACACGTCGGCCAAGCCGTGGCAGG
CGCTGCGCTCGAACGGCGGGCCGAACGGGATGGTGAGCCAGTCGGTGCTGAACTCGTACGAGACGGCCGA
GCGCATCCGCGGCGCGATGCTCGACGATTCGGGGCACCTGCGCGTGTCGACCGTGCTGCGTTTCATCGAC
ATGGATTCGCAGTTGTCCGAAGCGCAGCTGAGCGTGGCTGGGCAGACGGTGCGCTTCGCGCACGGCGTGA
CCTCGCCGCACCGGGTGGACTGGACCAACCAGAACACGCAGCTCGCGATCAAGCTGCAGCTCAAATCGGT
GGACGGCCGGATGACGACGCTGCAGTTCGACGGGCCGTGGGCGCTGTTCCGCTTCTTCGACGCGGGGCAG
GCGGTGGGCGGCACGGGCACCGCGGACCGGCGCGAGCGGCTGTATCAGACGAGCCTCGGCACGGTGCGCA
TCGAATGGCAGGCGCTCACGCTGCCGTCGCCGATATGGTCGGGCATCCTGCAGTCGTTCAGGTGTCCGTC
GTGA
 Primer design