SecReT6
Protein ID: 126446776
SecReT6 ID192
T6SS typei3
Gene symbol-
Locus tagBMA10247_A2004
StrainBurkholderia mallei NCTC 10247
Repliconchromosome II [GenBank: NC_009079] [Browse all T6SS(s) in this replicon]
Location [Strand]1933149..1933742 [-]
Productputative lipoprotein
NoteTssJ
UniProt IDA3MFZ4
KEGG IDbmn:BMA10247_A2004
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.20E-12, Aligned region: 19..154
Protein Sequence: 197 a.a.     [Download]
>gi|126446776|ref|YP_001079180.1| putative lipoprotein [Burkholderia mallei NCTC 10247]
MRHKMGPFKSIAAALALGVLAGCSAFSSSKPEEPRQLHVTLVGGARLNVAPTGEPRPVQTCVYVVTAADW
LPTQGGDDSSCASRGQDSTVVADSRHVIAPNQLLQFSLNLPRSGELWLVADADYARRPANYGPLRVRVEG
RGLIHMAVWLDRDGIYNALLPGPVPVGGAIAPAAVRPDEPPPERKTKTTYGTRRSRQ
 
Nucleotide Sequence: 594 bp     [Download]
>gi|126445587|ref|NC_009079.1|:c1933742-1933149 Burkholderia mallei NCTC 10247 chromosome II, complete sequence
GTGCGTCACAAGATGGGCCCCTTCAAATCGATCGCGGCGGCGCTCGCGCTCGGCGTGCTCGCCGGCTGCT
CGGCCTTCTCGTCGTCGAAGCCGGAAGAGCCGCGGCAGTTGCACGTGACGCTCGTCGGCGGCGCCCGGCT
GAACGTCGCGCCGACGGGCGAGCCGCGTCCGGTGCAGACGTGCGTGTATGTCGTGACCGCGGCCGACTGG
CTGCCGACGCAGGGCGGCGACGATTCGTCGTGCGCGTCGCGCGGGCAGGACAGCACGGTCGTCGCCGACT
CGCGGCACGTGATCGCGCCGAACCAGTTGCTGCAGTTCTCGCTGAACCTGCCGCGCTCGGGCGAGCTCTG
GCTCGTCGCCGACGCCGACTACGCGCGCCGGCCGGCGAACTACGGGCCGCTGCGCGTGCGCGTCGAGGGC
CGCGGCTTGATTCACATGGCTGTCTGGCTGGACCGCGACGGCATCTACAACGCGTTGTTGCCGGGGCCCG
TGCCCGTCGGCGGCGCGATCGCCCCGGCGGCGGTCCGCCCCGACGAGCCGCCGCCCGAGCGCAAGACGAA
AACCACCTATGGGACAAGGAGAAGCAGGCAATGA
 Primer design