SecReT6
Protein ID: 126447196
SecReT6 ID192
T6SS typei3
Gene symbol-
Locus tagBMA10247_A2001
StrainBurkholderia mallei NCTC 10247
Repliconchromosome II [GenBank: NC_009079] [Browse all T6SS(s) in this replicon]
Location [Strand]1930050..1931708 [-]
Producthypothetical protein
NoteTssL
UniProt IDA3MFZ1
KEGG IDbmn:BMA10247_A2001
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.00E-42, Aligned region: 122..317
OmpA [PF00691], Evalue: 5.00E-10, Aligned region: 376..483
Protein Sequence: 552 a.a.     [Download]
>gi|126447196|ref|YP_001079177.1| hypothetical protein BMA10247_A2001 [Burkholderia mallei NCTC 10247]
MLDRAAANPDLVTRVPTLSSLSSAAMTSSAVSTTGTTNTVASGGAAAGAPSFAPPAADAFPQADGAPRNP
AVLQFPVPGGAPAPADARVAAPVVYSAQGEQAAIMKAGLQQASWNNPFVSHALPAVLQLQRHLAAGPLNQ
AAIRTQLGLEVRLYRERLAASGCEWEQIRDASYLLCTYLDETVNDAAREHAQVVYDGERSLLVEFHDDAW
GGEDAFADLSRWMKTEPPPIPLLSFYELILSLGWQGRYRVLDRVDVLLQDLRSQLHALIWHHVPPEPLGT
ELVAPAKRRRSWWTAGRAAAVALGVLVLAYGAISFWLDSQGRPIRNALAAWMPPTRTINIAETLPPPLPQ
ILTEGWLTAYKHPQGWLLVFKSDGAFDVGKANVRADFMHNIERLGLAFAPWPGDLEVIGHTDSRPIRTSE
FPDNQALSEARARNVADELRKTALPGGARAPENAVQRNIEYSGRGDAQPIDTAKTAAAYERNRRVDVLWK
VIPDGAQQSGRSLNLQQPEKPGQVPMRPAMPEGVEIAPDGQLPYATSTTMPATRPTTEGRQP
 
Nucleotide Sequence: 1659 bp     [Download]
>gi|126445587|ref|NC_009079.1|:c1931708-1930050 Burkholderia mallei NCTC 10247 chromosome II, complete sequence
ATGCTCGATCGCGCGGCGGCGAATCCGGATCTCGTGACGCGCGTGCCGACGCTGTCGTCGCTGTCGAGCG
CGGCGATGACGAGCTCCGCCGTATCGACCACCGGCACGACGAACACGGTGGCGTCGGGCGGCGCGGCCGC
GGGCGCGCCGAGCTTCGCGCCGCCGGCCGCCGACGCGTTTCCCCAAGCCGACGGCGCGCCCCGCAACCCC
GCGGTGCTGCAATTCCCGGTGCCGGGCGGCGCGCCCGCGCCCGCCGACGCGCGGGTGGCCGCGCCCGTCG
TCTATAGCGCGCAGGGCGAGCAGGCCGCGATCATGAAAGCAGGCCTGCAGCAGGCGAGCTGGAACAACCC
GTTCGTGTCGCACGCGCTGCCCGCGGTGCTGCAACTGCAGCGCCACCTCGCGGCCGGCCCGCTCAATCAG
GCCGCGATCCGCACGCAGCTCGGCCTCGAGGTGCGGCTCTACCGCGAGCGGCTCGCCGCCTCCGGCTGCG
AATGGGAGCAGATCCGCGACGCATCGTACCTGCTCTGCACGTATCTCGACGAAACCGTCAACGACGCGGC
GCGCGAGCACGCGCAAGTCGTCTACGACGGCGAGCGCAGCCTGCTCGTCGAATTCCACGACGACGCGTGG
GGCGGCGAGGACGCGTTCGCCGACCTGTCGCGCTGGATGAAGACCGAGCCGCCGCCGATTCCGCTTCTGT
CGTTCTACGAACTGATCCTGTCGCTCGGCTGGCAGGGCCGCTACCGCGTGCTCGACCGCGTCGACGTGCT
GCTGCAGGATCTGCGCTCGCAACTGCACGCGCTGATCTGGCATCACGTGCCGCCCGAGCCGCTCGGCACC
GAGCTCGTCGCGCCCGCGAAGCGGCGCCGCTCGTGGTGGACGGCCGGGCGCGCGGCGGCCGTCGCGCTCG
GCGTGCTGGTGCTCGCGTACGGCGCGATCAGCTTCTGGCTCGATTCGCAGGGCCGCCCGATCCGCAACGC
GCTCGCCGCGTGGATGCCGCCCACGCGCACGATCAACATCGCCGAGACGCTGCCGCCGCCGCTGCCGCAG
ATTCTCACCGAAGGGTGGCTCACCGCGTACAAGCATCCGCAAGGATGGCTGCTCGTGTTCAAGAGCGACG
GCGCGTTCGACGTCGGCAAGGCGAACGTGCGGGCGGACTTCATGCACAACATCGAGCGGCTCGGCCTCGC
GTTCGCGCCGTGGCCGGGCGACCTCGAGGTGATCGGCCACACCGATTCGCGGCCGATCCGCACGAGCGAG
TTCCCGGACAACCAGGCGCTGTCCGAAGCGCGGGCGCGCAACGTCGCCGACGAACTGCGCAAGACCGCGC
TGCCGGGCGGCGCGCGCGCGCCGGAGAACGCGGTGCAGCGCAACATCGAGTACTCGGGGCGCGGCGACGC
GCAGCCGATCGACACCGCGAAGACGGCCGCCGCGTACGAGCGCAACCGCCGCGTCGACGTGCTGTGGAAG
GTGATTCCCGACGGCGCGCAGCAATCGGGCCGCAGCCTGAACCTGCAGCAGCCGGAGAAGCCCGGGCAGG
TGCCGATGCGTCCGGCGATGCCGGAGGGCGTGGAGATCGCGCCTGACGGGCAACTGCCGTATGCGACGTC
AACCACGATGCCAGCAACGCGACCGACCACGGAGGGCCGTCAGCCATGA
 Primer design