SecReT6
Protein ID: 126447493
SecReT6 ID191
T6SS typei1
Gene symbol-
Locus tagBMA10247_A1688
StrainBurkholderia mallei NCTC 10247
Repliconchromosome II [GenBank: NC_009079] [Browse all T6SS(s) in this replicon]
Location [Strand]1630372..1634331 [+]
Producthypothetical protein
NoteTssM
UniProt IDA3MF35
KEGG IDbmn:BMA10247_A1688
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.20E-48, Aligned region: 171..416
ImcF-related_N [PF14331], Evalue: 3.20E-48, Aligned region: 1078..1118
Protein Sequence: 1319 a.a.     [Download]
>gi|126447493|ref|YP_001078871.1| hypothetical protein BMA10247_A1688 [Burkholderia mallei NCTC 10247]
MMIARIAALLALAALSWASALYFDWPLWCAPAVFCAALAGWLLCRVARRALRAVRARAQLARLDASERLP
AADAPELRVAARWRTALAALGRAQPAPRLRGRPRDALPWYLVIGPEGAGKTTALARARLASPLRHARDDA
AIAPTEDCDWWCFDDAVVLDLAGRFAAPGATDDDRRAWHALLEQLGRARARRGVNGVVVAIDAPRLIEAS
RDALTIEGSAIRERLEQLIRLFDRRFPVYVLVTQCDRLYGFDEWAAQLAPEQRERAFGYLGDHDADAFVA
RALDSLDARLGALRVALAARGEPPSPRALMLPHELACLRPALEAFARAAFGPNVYQETPYLRGLLFASGR
QAGGAPSLTLPDWLDAAPARTPGDAGLFLHDVFARVLPGERDAWLPVERPSRSRLVLRRLALAAWLLASV
AAGLLMSASFVGDMRTVELVRRDYPAHPRFTGEFAHDTATLARIGRVIADVERRDERRLVRPLAGATPVG
RLEAELKRRYVAHYRRSIEPTADRLFFGKPDGASDMRAANDARLAARIRNLVRYVNLMQARRRGADRETL
AQMPAPAVARATDGGGARGVDSVGVSGVSGVSGVSGGVGGVGGARAAEGAGRAVRASGGRRAGDARAARG
MRGAAGNAGAGAEIAPAADGVRDRDEGFARVSALAVDLIAWSAPDDRALAARVAAAQAELERLAYRDPDG
AWLLALPDASMPRDVTLADFWPAAEPRTLPDAQPAALRDVRVPAALTAAHRPAIDAFLDEMAQAVANRPK
FAFHRDAFDTWYRARRIDAWRDFVARFPQGEQGLTTQAQWRAVIDRIADHRDPFAALLARVDREFESERD
DTLPPWLRFVRTTSHMLAPAMLAPARLPAASGGLGAALGSISRSGGRALREALGGAPEQGRLTLERDAAL
RDALVDYERRVAALAADALAGPGAAYRLAADFHGFGVDPSVQASAMRAADSALRDVKRLAGDRDVGGDVV
WSLVGGPLRALIAYVERQASCALQDDWERDVLWPLRRAATRDDVEGLLYGPQGAIWAFVDGPAKPFVRVG
AARASALDTLGYRLPFTDAFLPLIDDAAARRVAQARRDAERRAQQQAALELDERIASLGKQIDALRAQTV
RFGIVAQPTDVNPDAQAKPFETVLTLQCAPQARTLTNYNLRVSEQIDWQPDRCGDATLRISLGGVTLVRR
YAGSLGVARFVQDFRYGVRRFTPRDFPDAKAQLQRLGVRHIDVRYDFSGHDALLAHVGRIDALERARRDD
LARQRRAANRQDDDAGGATAIARAAASVANAPGAALPRRIGVCWGDPAHDRPDGDGAQP
 
Nucleotide Sequence: 3960 bp     [Download]
>gi|126445587|ref|NC_009079.1|:1630372-1634331 Burkholderia mallei NCTC 10247 chromosome II, complete sequence
ATGATGATCGCGCGGATCGCCGCGCTGCTCGCGCTCGCCGCGCTCAGTTGGGCGAGCGCGCTCTATTTCG
ACTGGCCGCTCTGGTGCGCGCCCGCCGTGTTCTGCGCGGCGCTCGCCGGATGGCTGCTGTGCCGCGTCGC
GCGCCGCGCGCTGCGCGCGGTTCGTGCGCGCGCGCAGCTCGCACGGCTCGACGCATCCGAGCGCCTGCCC
GCGGCCGACGCGCCGGAGCTGCGCGTCGCCGCGCGCTGGCGCACCGCGCTCGCCGCGCTCGGGCGCGCGC
AGCCCGCGCCGCGCCTGCGCGGCCGGCCGCGCGACGCGCTGCCGTGGTATCTCGTGATCGGCCCCGAGGG
CGCGGGCAAGACAACCGCGCTCGCGCGCGCGCGCCTCGCGTCGCCGCTGCGGCACGCGCGCGACGACGCG
GCCATCGCGCCGACCGAGGACTGCGACTGGTGGTGCTTCGACGACGCGGTCGTGCTCGATCTCGCGGGCC
GCTTCGCCGCGCCCGGCGCGACCGACGACGATCGCCGCGCATGGCACGCGCTCCTCGAGCAGCTCGGCCG
CGCGCGTGCGCGCCGGGGCGTGAACGGCGTCGTGGTCGCGATCGACGCGCCGCGCCTCATCGAAGCGAGC
CGCGATGCGCTGACGATCGAAGGCAGCGCCATTCGCGAACGGCTCGAGCAACTGATCCGCCTGTTCGACC
GGCGCTTTCCGGTGTACGTGCTCGTCACGCAATGCGACCGGCTCTACGGCTTCGACGAATGGGCCGCGCA
GCTCGCGCCGGAACAACGCGAGCGCGCGTTCGGCTATCTCGGCGATCACGACGCGGATGCGTTCGTCGCG
CGCGCGCTCGACAGCCTCGACGCACGGCTCGGCGCGCTGCGCGTCGCGCTGGCGGCGCGCGGCGAGCCGC
CGTCGCCGCGCGCGCTGATGCTGCCGCACGAACTCGCGTGCCTGCGGCCCGCGCTCGAGGCGTTCGCACG
CGCGGCGTTCGGCCCGAACGTCTATCAGGAAACACCGTATCTGCGCGGGCTGCTGTTCGCGAGCGGCCGG
CAGGCGGGCGGCGCGCCGTCGCTGACGCTGCCCGACTGGCTCGACGCCGCGCCGGCGCGCACGCCCGGCG
ATGCGGGCCTGTTCCTGCACGACGTGTTCGCGCGCGTGCTGCCGGGCGAGCGCGACGCGTGGCTGCCCGT
CGAGCGGCCGAGCCGCTCGCGGCTCGTGCTGCGGCGCCTCGCGCTCGCCGCGTGGCTCCTCGCGAGCGTC
GCGGCCGGGCTGCTGATGAGCGCATCGTTCGTCGGCGACATGCGAACCGTCGAGCTGGTCCGCCGCGACT
ATCCCGCGCATCCGCGCTTCACCGGCGAATTCGCGCACGACACGGCGACGCTCGCGCGGATCGGCCGCGT
GATCGCCGACGTCGAGCGGCGCGACGAGCGGCGGCTCGTGCGCCCGCTCGCCGGCGCGACGCCCGTCGGC
CGGCTCGAAGCGGAACTCAAGCGCCGCTACGTCGCACACTATCGGCGCTCGATCGAACCCACCGCCGATC
GGCTGTTCTTCGGCAAGCCGGACGGCGCGAGCGACATGCGCGCGGCCAACGATGCGCGGCTCGCCGCGCG
CATCCGCAATCTGGTCCGCTACGTGAACCTGATGCAGGCGCGCCGGCGCGGCGCGGATCGCGAGACGCTC
GCGCAAATGCCCGCACCGGCGGTCGCGCGCGCGACGGATGGCGGTGGCGCTCGCGGAGTGGACAGTGTGG
GTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTCTGGCGGTGTAGGCGGTGTAGGCGGTGCGCGCGCCGC
GGAAGGTGCGGGTCGCGCCGTCCGCGCGAGCGGCGGACGGCGCGCAGGCGACGCGCGCGCCGCGCGCGGC
ATGCGCGGCGCCGCCGGCAACGCCGGCGCCGGCGCTGAAATCGCACCCGCCGCAGACGGCGTTCGCGATC
GCGACGAAGGGTTTGCGCGCGTCAGCGCGCTCGCCGTCGACCTGATCGCGTGGAGCGCGCCCGACGATCG
CGCGCTCGCCGCGCGCGTCGCGGCCGCGCAGGCAGAGCTCGAACGGCTCGCGTACCGCGATCCGGACGGC
GCGTGGCTGCTCGCGCTACCGGATGCCTCGATGCCGCGCGACGTGACGCTCGCCGATTTCTGGCCCGCCG
CCGAGCCGCGCACGCTGCCCGACGCACAGCCCGCCGCGCTGCGCGACGTGCGCGTGCCCGCCGCGCTGAC
GGCCGCGCATCGCCCGGCCATCGATGCGTTCCTCGACGAGATGGCGCAGGCGGTCGCGAACCGGCCGAAG
TTCGCGTTCCATCGCGACGCGTTCGACACGTGGTACCGCGCACGGCGCATCGACGCATGGCGCGACTTCG
TCGCACGCTTCCCGCAGGGCGAGCAAGGGCTGACGACGCAAGCGCAATGGCGCGCGGTGATCGACCGGAT
CGCCGATCACCGCGATCCGTTCGCGGCATTGCTCGCGCGCGTCGATCGCGAATTCGAATCCGAGCGCGAC
GACACGCTGCCGCCGTGGCTACGGTTCGTGCGCACGACATCGCACATGCTCGCCCCCGCGATGCTCGCGC
CCGCGCGCCTGCCCGCGGCGAGCGGCGGCCTGGGCGCCGCGCTCGGCTCGATCTCGCGCAGCGGCGGACG
CGCGCTGCGCGAAGCGCTCGGCGGCGCACCCGAGCAAGGCAGGCTCACGCTCGAGCGCGACGCCGCGCTG
CGCGACGCGCTTGTCGACTACGAGCGGCGCGTCGCCGCGCTCGCCGCCGACGCGCTCGCGGGCCCCGGCG
CCGCGTACCGGCTCGCGGCCGATTTCCACGGCTTCGGCGTCGATCCGTCCGTCCAGGCTTCCGCGATGCG
CGCGGCCGACAGCGCGCTGCGCGACGTCAAGCGGCTCGCGGGCGATCGCGACGTCGGCGGCGACGTCGTC
TGGAGCCTCGTCGGCGGCCCGCTGCGCGCGCTGATCGCGTATGTCGAGCGGCAGGCGTCGTGCGCGCTGC
AGGACGACTGGGAGCGCGACGTGCTGTGGCCGCTCAGGCGCGCGGCGACGCGCGACGACGTGGAGGGTCT
GCTGTACGGCCCGCAAGGCGCGATCTGGGCGTTCGTCGACGGCCCGGCGAAGCCGTTCGTGCGTGTCGGC
GCGGCGCGTGCGTCGGCGCTCGACACGCTCGGCTACCGGCTGCCGTTCACCGACGCGTTCCTGCCGCTCA
TCGACGACGCGGCCGCCCGGCGCGTCGCGCAAGCGCGGCGCGACGCCGAGCGGCGCGCGCAACAGCAGGC
GGCGCTCGAGCTGGACGAGCGGATCGCATCGCTCGGCAAGCAGATCGACGCGCTGCGCGCGCAAACGGTG
CGCTTCGGGATCGTCGCGCAGCCGACCGACGTGAACCCGGATGCGCAGGCCAAGCCGTTCGAAACCGTGC
TGACGCTGCAATGCGCGCCGCAGGCGCGCACGCTGACGAACTACAACCTGCGCGTGTCCGAGCAGATCGA
CTGGCAACCCGATCGATGCGGCGACGCGACGCTGCGCATCTCGCTCGGCGGCGTCACGCTCGTGCGCCGT
TACGCGGGATCGCTCGGCGTCGCGCGCTTCGTCCAGGACTTCCGCTACGGCGTGCGCCGCTTCACGCCCC
GCGATTTCCCGGACGCGAAAGCGCAGCTTCAACGTCTCGGCGTGCGCCACATCGACGTGCGTTACGACTT
CTCCGGGCATGACGCGCTGCTCGCGCACGTCGGTCGGATCGACGCGCTCGAACGCGCGCGCCGCGACGAC
CTCGCGCGGCAGCGGCGCGCCGCGAACCGGCAGGACGACGACGCGGGCGGCGCGACGGCGATCGCGCGGG
CGGCGGCGTCCGTCGCGAATGCGCCGGGCGCCGCGCTGCCCCGCCGCATCGGCGTGTGTTGGGGGGACCC
GGCGCACGACAGGCCCGATGGCGACGGCGCGCAACCGTGA
 Primer design