SecReT6
Protein ID: 126447820
SecReT6 ID192
T6SS typei3
Gene symbol-
Locus tagBMA10247_A2017
StrainBurkholderia mallei NCTC 10247
Repliconchromosome II [GenBank: NC_009079] [Browse all T6SS(s) in this replicon]
Location [Strand]1949797..1951302 [-]
Producthypothetical protein
NoteTssC
UniProt IDA3MG07
KEGG IDbmn:BMA10247_A2017
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.80E-183, Aligned region: 67..493
Protein Sequence: 501 a.a.     [Download]
>gi|126447820|ref|YP_001079193.1| hypothetical protein BMA10247_A2017 [Burkholderia mallei NCTC 10247]
MQQLESSAEKVVVDQNNVNEDLKDILRRSFRPRTNEAAEAVQNAVETLLTYARRSRVVVREDVAQTIEQL
VAELDKKISEQLTLVLHNKRFQSLEGAWRGLHYLVSNTDTSENLKIRYLNISKADLGKTLRRFKGVVWDQ
SPIFKMIYEQEYGQFGGEPFGCLIGDFYFDHSMQDVSILTEMSKISAAAHAPFIAAAAPGLLQMDDWSEL
SNPRDVSKIFTATEYAFWRRLRESNDSRYLALTLPRFLARVPYGPKTQPVEEFGFEEKVDPNRAEDFCWA
NSAYAMGANITRAFKTYGWCTKIRGVESGGAVEVLPKFVLPSQDREVDLHCPTEIAISDRREHELSESGL
MPLVYRKNSDTAAFIGAKTVHRPAIYEDDDATANSNLSSRLPYIFATCRFAHYLKCIVRDKIGSFKSAED
TQRWLNDWLMNYVDGDPSISSEVTKSQRPLSAAEVVVDEIPENPGYYRAQFFLRPHFQLEGLTVSLRLVS
KLPSTKHEVTT
 
Nucleotide Sequence: 1506 bp     [Download]
>gi|126445587|ref|NC_009079.1|:c1951302-1949797 Burkholderia mallei NCTC 10247 chromosome II, complete sequence
ATGCAGCAGCTTGAATCGTCTGCCGAGAAGGTGGTCGTCGATCAGAACAACGTCAACGAGGATCTGAAGG
ACATCCTGCGCCGCTCGTTCCGGCCGCGCACCAACGAGGCGGCCGAGGCGGTGCAGAACGCGGTCGAGAC
GCTGCTCACGTATGCGCGGCGCAGCCGGGTCGTGGTTCGTGAGGATGTCGCGCAGACGATCGAGCAGCTG
GTTGCCGAGCTCGACAAGAAGATCTCCGAGCAACTGACGCTCGTGCTGCACAACAAGCGCTTTCAGAGCC
TCGAAGGCGCGTGGCGCGGATTGCACTACCTCGTGTCGAACACCGATACGAGCGAGAACCTGAAGATCCG
CTACCTGAACATCTCGAAAGCGGATCTCGGCAAGACGCTGCGGCGCTTCAAGGGCGTCGTGTGGGATCAG
AGTCCGATTTTCAAGATGATCTACGAGCAGGAGTACGGCCAGTTCGGCGGCGAGCCGTTCGGCTGCCTGA
TCGGCGACTTCTATTTCGACCACAGCATGCAGGACGTGTCGATCCTCACCGAGATGTCGAAGATCTCGGC
GGCCGCTCACGCGCCGTTCATCGCGGCTGCCGCGCCCGGCCTGCTGCAGATGGACGACTGGAGCGAGCTG
TCGAACCCGCGCGACGTGTCGAAGATCTTCACGGCGACCGAGTATGCGTTCTGGCGGCGCCTGCGCGAGA
GCAACGACTCGCGCTACCTCGCGCTCACGCTGCCGCGCTTCCTCGCGCGTGTGCCGTATGGTCCGAAGAC
GCAGCCCGTCGAAGAGTTCGGCTTCGAGGAGAAGGTCGATCCGAACCGCGCGGAGGATTTCTGCTGGGCG
AACTCCGCGTATGCGATGGGCGCGAACATCACGCGCGCGTTCAAGACCTACGGCTGGTGCACGAAGATTC
GCGGCGTCGAGTCGGGCGGCGCGGTCGAGGTGCTGCCGAAGTTCGTGCTGCCGTCGCAGGATCGCGAAGT
CGATCTGCATTGCCCGACCGAGATCGCGATCTCGGACCGCCGCGAGCACGAATTGTCCGAGTCGGGCCTG
ATGCCGCTCGTGTATCGGAAGAATTCGGATACGGCCGCGTTCATCGGCGCGAAGACCGTGCATCGTCCGG
CGATCTACGAGGACGACGACGCGACCGCGAACTCGAACCTGTCGTCGCGGCTGCCGTACATCTTCGCGAC
CTGCCGTTTCGCGCATTACCTGAAGTGCATCGTGCGCGACAAGATCGGTTCGTTCAAGTCGGCCGAGGAC
ACGCAGCGCTGGCTCAACGACTGGCTGATGAACTACGTGGACGGCGACCCGAGCATCTCGAGCGAGGTGA
CGAAGTCGCAGCGTCCGCTGTCGGCGGCGGAGGTGGTCGTCGACGAGATTCCGGAAAACCCCGGCTACTA
TCGCGCGCAGTTCTTCCTGCGCCCCCATTTCCAACTGGAGGGTTTGACCGTTTCTCTCCGGCTGGTTTCG
AAGCTTCCGTCGACCAAGCACGAGGTGACGACCTGA
 Primer design