SecReT6
Protein ID: 126448063
SecReT6 ID194
T6SS typeN/A
Gene symbol-
Locus tagBMA10247_3148
StrainBurkholderia mallei NCTC 10247
Repliconchromosome I [GenBank: NC_009080] [Browse all T6SS(s) in this replicon]
Location [Strand]3110398..3111519 [+]
ProductImpA-related N-terminal family protein
NoteTssA
UniProt IDA3MQY0
KEGG IDbmn:BMA10247_3148
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.30E-24, Aligned region: 55..116
ImpA-rel_N [PF06812], Evalue: 3.30E-24, Aligned region: 130..145
Protein Sequence: 373 a.a.     [Download]
>gi|126448063|ref|YP_001082666.1| ImpA-related N-terminal family protein [Burkholderia mallei NCTC 10247]
MPTNLTELLTPISEASPCGDDLLFSAEFDAIQHARKFDDPSLDQGEWITDIKEADWGFVVEQASALLRER
TKDLRLAVWLTEALAIEDGIGGLTQGYTLLTSLCRQFWDHVHPLPDGDDAEYRLGNVAWLAGRTVDLLRA
VPLTDGAANAFSELDWDVAQHVAQAIRRDPEQASEIARGKPSVEQIEASKRMTPVAFYARLLGELKAFQA
ALDALEQELDGRAGDAAPSFRQARDAYETVYRLAERFAKEQGYSADAQPQAVAPPAPSERAEPSFKTPLH
SEEPVPRHAHAPCAPAPIVIAGIQNRAQAVEQLRAVAKYFRGTEPHSPVAYLADKAAEWADMPLHQWLAS
VVKDDGSLAHIRELLGLKPDDNA
 
Nucleotide Sequence: 1122 bp     [Download]
>gi|126447966|ref|NC_009080.1|:3110398-3111519 Burkholderia mallei NCTC 10247 chromosome I, complete sequence
ATGCCGACCAACCTCACCGAGCTGCTGACGCCGATCAGCGAAGCGTCGCCGTGCGGCGACGATCTCCTGT
TCTCCGCCGAATTCGACGCGATCCAGCACGCGCGCAAGTTCGACGATCCGTCGCTCGACCAGGGCGAATG
GATCACCGATATCAAGGAAGCGGACTGGGGCTTCGTCGTCGAGCAAGCGAGCGCGCTGTTGCGCGAGCGC
ACGAAGGATCTGCGGCTCGCGGTATGGCTGACCGAGGCGCTCGCGATCGAGGACGGCATCGGTGGGCTCA
CGCAGGGCTACACGCTGCTCACGAGCCTCTGCCGGCAGTTCTGGGACCACGTGCATCCGCTGCCCGACGG
CGACGACGCCGAATACCGGCTCGGCAACGTCGCGTGGCTCGCCGGGCGCACGGTCGATCTGCTGCGCGCG
GTGCCGCTCACCGACGGCGCGGCGAATGCGTTCAGCGAGCTCGACTGGGACGTCGCGCAACACGTCGCGC
AGGCGATCCGGCGCGATCCCGAACAGGCGAGCGAGATCGCGCGCGGCAAGCCGTCCGTCGAGCAGATCGA
GGCGTCGAAGCGGATGACGCCCGTGGCGTTCTACGCGCGGCTGCTCGGCGAGCTGAAAGCGTTCCAGGCG
GCGCTCGACGCGCTCGAGCAGGAACTCGACGGGCGGGCGGGCGACGCGGCGCCGAGCTTCCGGCAGGCGC
GCGACGCGTACGAAACCGTCTACCGGCTCGCCGAACGCTTCGCGAAGGAGCAGGGCTACTCGGCCGACGC
GCAGCCGCAGGCCGTCGCGCCGCCCGCGCCGAGCGAGCGCGCGGAGCCGAGCTTCAAGACGCCGCTTCAT
TCGGAGGAACCCGTGCCGAGACACGCACACGCGCCGTGCGCGCCCGCGCCGATCGTGATCGCCGGCATTC
AGAATCGCGCACAGGCCGTCGAGCAACTGCGCGCGGTCGCGAAATATTTCCGCGGAACCGAGCCGCACAG
CCCCGTCGCGTATCTCGCCGACAAGGCGGCCGAATGGGCGGACATGCCGCTGCATCAATGGCTTGCGTCG
GTCGTCAAGGACGACGGCTCGCTCGCGCATATCCGCGAGCTGCTCGGCCTGAAGCCGGACGATAACGCGT
GA
 Primer design