SecReT6
Protein ID: 126450255
SecReT6 ID194
T6SS typeN/A
Gene symbol-
Locus tagBMA10247_3149
StrainBurkholderia mallei NCTC 10247
Repliconchromosome I [GenBank: NC_009080] [Browse all T6SS(s) in this replicon]
Location [Strand]3111718..3112650 [-]
ProductompA family protein
NoteTagL
UniProt IDA3MQY1, A3MQY1
KEGG IDbmn:BMA10247_3149
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 2.90E-25, Aligned region: 144..177
OmpA [PF00691], Evalue: 2.90E-25, Aligned region: 208..302
BON [PF04972], Evalue: 0.0031, Aligned region: 81..119
BON [PF04972], Evalue: 0.0031, Aligned region: 156..169
Protein Sequence: 310 a.a.     [Download]
>gi|126450255|ref|YP_001082667.1| ompA family protein [Burkholderia mallei NCTC 10247]
MTKPRLPLLRACRFALALAALALGGAARADNVGPATVTPIDAGGVPVKSVPLAAPVTAAPVAATAGAGAT
VSSPPPANATPGQVVAGGKVADEATKAAVLQRLRDTYGAANVVDQIEIGNVATPPNWSANVQKLIGPQLK
QISKGQLKIDGTQIDVKGEVHNEAQRQQLASDMANALNPTYTIKNGLRVSASEQGLLDQTLANRTIEFET
GSATLTPQGRAILDQMAGALAKMSSRTVEIIGHTDNSGNRTSNIALSQARADAVKGYLVTKGIASQQLTT
TGVGPDQPIAPNDSADGRARNRRIEFRAGQ
 
Nucleotide Sequence: 933 bp     [Download]
>gi|126447966|ref|NC_009080.1|:c3112650-3111718 Burkholderia mallei NCTC 10247 chromosome I, complete sequence
ATGACGAAGCCCCGCCTGCCCCTGCTGCGCGCCTGCCGCTTCGCGCTCGCGCTCGCCGCGCTCGCGCTCG
GCGGCGCCGCGCGCGCCGACAACGTCGGCCCCGCCACCGTCACGCCGATCGACGCAGGCGGCGTGCCCGT
GAAATCGGTGCCGCTCGCCGCGCCCGTGACGGCCGCGCCGGTCGCCGCGACGGCCGGCGCGGGCGCGACC
GTGTCGTCGCCGCCGCCCGCGAACGCGACGCCGGGCCAGGTCGTCGCCGGCGGCAAGGTCGCCGACGAAG
CGACGAAGGCCGCCGTGCTGCAGCGCCTGCGCGACACGTACGGCGCCGCGAACGTCGTCGACCAGATCGA
AATCGGCAACGTCGCGACGCCGCCGAACTGGTCCGCGAACGTCCAGAAGCTGATCGGCCCGCAACTGAAA
CAGATCAGCAAAGGACAGCTGAAGATCGACGGCACGCAGATCGACGTGAAGGGCGAAGTGCACAACGAGG
CGCAGCGCCAGCAGCTCGCGAGCGACATGGCGAACGCGCTGAATCCGACCTACACGATCAAGAACGGGCT
GCGCGTGAGCGCGTCCGAGCAGGGCCTGCTCGACCAGACGCTCGCGAACCGCACGATCGAATTCGAAACC
GGCAGCGCGACGCTCACGCCGCAAGGCCGCGCGATTCTCGACCAGATGGCGGGCGCGCTCGCGAAGATGT
CGAGCCGAACGGTCGAGATCATCGGGCACACCGACAACTCGGGCAACCGCACGTCGAACATCGCGCTCAG
CCAGGCGCGCGCGGACGCGGTCAAGGGATATCTGGTGACGAAGGGCATCGCGTCGCAGCAACTGACGACG
ACGGGCGTCGGCCCCGATCAGCCGATCGCGCCGAACGATTCGGCCGACGGGCGCGCGCGCAATCGCCGGA
TCGAATTCCGCGCGGGACAGTAA
 Primer design