SecReT6
Protein ID: 126455565
SecReT6 ID186
T6SS typei3
Gene symbol-
Locus tagBURPS1106A_A0249
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]239001..240086 [+]
Producthypothetical protein
NoteTssG
UniProt IDA3P1T2
KEGG IDbpl:BURPS1106A_A0249
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 8.30E-101, Aligned region: 24..325
Protein Sequence: 361 a.a.     [Download]
>gi|126455565|ref|YP_001074292.1| hypothetical protein BURPS1106A_A0249 [Burkholderia pseudomallei 1106a]
MARDMTQAAVADTALSPQALARLRAEPWRYGFLALLRRIGADARIDPIGKARRPQAEPFRLGQQPSLAFA
PREIASVGDANGRLKVRLFGLGMLGPNGPLPIHVTEIARDREESRRDPTLGNFLDIFHHRYLTLLYRAWA
SAQAAAGLDRPDDERFSFYVASLAGQDLDEVGARPLPAHARLSASPHLVREARNADGLRMTLERYFGVPV
TLEENVFHWIAVDPLEHSRLGRPGDASTMAAGALLGELVPDRQHKFRLVFGPLDIDAYLRFTPRGEDLPR
LVEWVRAFVGYEFEWELELRIKPNGAPPAVMGGPHQLGWSGWLGRSPSGEPVTGMRFEPEHYAHGFARGT
ARDTRGMRGER
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|126455463|ref|NC_009078.1|:239001-240086 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGGCGCGCGACATGACGCAGGCGGCCGTTGCCGACACGGCGCTGTCGCCGCAAGCGCTCGCGCGGCTGC
GCGCCGAACCGTGGCGCTATGGGTTCCTCGCGCTGCTGCGCCGCATCGGCGCGGATGCGCGCATCGATCC
GATCGGCAAGGCGAGGCGCCCGCAGGCGGAGCCGTTTCGCCTCGGCCAGCAGCCGAGCCTCGCGTTCGCG
CCGCGCGAGATCGCCAGCGTCGGCGACGCGAACGGGCGGCTCAAGGTGCGGCTGTTCGGGCTCGGGATGC
TGGGGCCGAACGGGCCGCTGCCGATCCACGTGACGGAGATCGCGCGCGATCGCGAGGAGAGCCGGCGCGA
TCCGACGCTCGGCAATTTTCTCGACATCTTCCATCATCGCTATCTGACGCTGCTGTATCGCGCGTGGGCG
TCGGCGCAGGCGGCGGCCGGCCTCGATCGTCCGGACGACGAACGGTTTTCGTTCTACGTCGCGAGCCTCG
CCGGCCAGGATCTCGACGAGGTCGGCGCGCGGCCGCTGCCCGCGCACGCGCGGCTGTCCGCCTCGCCGCA
TCTGGTGCGCGAGGCGCGCAACGCGGACGGCCTGCGAATGACGCTCGAACGTTACTTCGGCGTGCCGGTG
ACGCTGGAGGAAAACGTATTTCACTGGATCGCCGTCGATCCGCTCGAGCACAGCCGGCTCGGCCGGCCCG
GCGACGCATCGACGATGGCCGCGGGCGCGCTGCTCGGCGAGCTGGTGCCGGATCGGCAGCACAAGTTCCG
GCTCGTGTTCGGGCCGCTCGACATCGACGCCTATCTGCGCTTCACGCCGCGGGGCGAGGATCTGCCGCGG
CTCGTCGAATGGGTGCGGGCGTTCGTCGGCTACGAGTTCGAGTGGGAGCTCGAGTTGCGGATCAAGCCGA
ACGGCGCGCCGCCCGCCGTGATGGGCGGCCCGCATCAACTCGGCTGGTCGGGCTGGCTCGGCCGCTCGCC
GTCCGGCGAGCCGGTGACGGGCATGCGTTTCGAACCCGAGCACTATGCGCACGGGTTCGCGCGCGGCACG
GCTCGCGACACGCGCGGCATGCGAGGTGAACGATGA
 Primer design