SecReT6
Protein ID: 126456114
SecReT6 ID186
T6SS typei3
Gene symbolsciN
Locus tagBURPS1106A_A0239
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]227995..228498 [-]
ProductSciN protein
NoteTssJ
UniProt IDA3P1S2
KEGG IDbpl:BURPS1106A_A0239
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.40E-40, Aligned region: 14..160
Protein Sequence: 167 a.a.     [Download]
>gi|126456114|ref|YP_001074282.1| SciN protein [Burkholderia pseudomallei 1106a]
MHPTTPVAAVALALACAACASGAAKQKEPLRLELAVRAAPTVNPDDRSRPAPIVVSVYELKTDGAFNAAD
FFTLQGPDKTVLADDLLARERFQLRPGERRVIRRDADPAAGALGVVAAYRDLPNSVWRAAYPLPPARDAA
WYRFSSPKLKLTIELDTHAIRITEPGK
 
Nucleotide Sequence: 504 bp     [Download]
>gi|126455463|ref|NC_009078.1|:c228498-227995 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGCATCCGACCACCCCCGTTGCCGCCGTCGCGCTCGCGCTCGCGTGCGCCGCGTGCGCGAGCGGCGCGG
CCAAGCAGAAGGAGCCGCTGCGGCTCGAGCTCGCCGTGCGCGCCGCGCCCACGGTCAATCCGGACGATCG
GAGCCGGCCGGCTCCGATCGTCGTGAGCGTCTACGAGCTGAAGACCGACGGCGCATTCAACGCCGCCGAT
TTCTTCACGCTGCAGGGCCCGGACAAGACCGTGCTCGCCGACGATCTGCTCGCGCGCGAGCGTTTTCAAC
TGCGCCCCGGCGAGCGCCGCGTGATCCGGCGCGACGCCGATCCGGCGGCGGGCGCGCTCGGCGTCGTCGC
CGCGTACCGCGATCTGCCGAACTCGGTGTGGCGCGCGGCATATCCGCTGCCGCCCGCGCGGGACGCCGCA
TGGTATCGCTTCTCGTCGCCGAAGCTGAAGCTGACCATCGAGCTCGACACGCACGCGATCAGGATCACCG
AACCCGGAAAATGA
 Primer design