SecReT6
Protein ID: 126456248
SecReT6 ID186
T6SS typei3
Gene symbol-
Locus tagBURPS1106A_A0248
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]237112..239001 [+]
Producthypothetical protein
NoteTssF
UniProt IDA3P1T1
KEGG IDbpl:BURPS1106A_A0248
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.10E-214, Aligned region: 5..626
Protein Sequence: 629 a.a.     [Download]
>gi|126456248|ref|YP_001074291.1| hypothetical protein BURPS1106A_A0248 [Burkholderia pseudomallei 1106a]
MDPQLLNYYNQELIYMRELGAEFARAHPKIARRLGMQAGEVADPYVERLIESFCFMAARMQIKLDAEFPR
FTGRLLEVLYPNYVAPTPSMAVARLYPSRTEGNLAQGFRVARGTAFAARVPAGEKTACRFRSGQDVTLYP
LEIADARLTGIPPDIPALDRYVPAGAQVRGALRLRLRTTGNMRIADLRGLDRLPLYLAGDAQVASHLFEL
LHVAGVATLTAAPGEFAAPGRPPAAVTVDALAHEGLGADEGLLPLTWAKFHGHNLLHEYFACPERFYFVA
LTGLEEGLRRIAGSEVEIVVLLEQSPERLADVVDASRFALFCTPVINLFPRHMDRIELSSGQTECHLVPA
RLAPLDYEVFSVEAMYGQVAATSAELEFRPLYQTLNDDESNYGRYFSTRRERRLVSDFARRYGTRTPYVG
TEMFVSLVDQNEAPYSEDIRYLSVDALVTNRDLPSLVPRDGVRDLTAIESAPIDSVGLIRAPSAPKAPYA
EREIAWRLIRQLNFNYLPLDELDHRAGGQGLRGLLRLFLAGDEADSRRQVESLVGVKTRPVTRKLPGAGP
LVFGRGVECALSVDETGFSGVSPYLFGLVLEHYLARHVSINVFTQTELNSIQRGRIARWPVRMGARGGA
 
Nucleotide Sequence: 1890 bp     [Download]
>gi|126455463|ref|NC_009078.1|:237112-239001 Burkholderia pseudomallei 1106a chromosome II, complete sequence
GTGGACCCGCAATTGCTCAACTACTACAACCAGGAACTGATCTACATGCGCGAGCTCGGCGCCGAGTTCG
CGCGCGCGCACCCGAAGATTGCGCGGCGCCTCGGAATGCAGGCGGGCGAAGTGGCCGATCCGTACGTCGA
GCGGCTGATCGAATCGTTCTGCTTCATGGCCGCGCGCATGCAGATCAAGCTCGATGCGGAATTTCCGCGC
TTCACCGGCCGCCTGCTCGAGGTGCTCTATCCGAACTATGTCGCGCCGACGCCGTCGATGGCGGTCGCGC
GCCTGTACCCGAGCCGCACCGAAGGCAACCTCGCGCAAGGCTTTCGCGTCGCGCGCGGCACCGCGTTTGC
CGCGCGCGTGCCGGCCGGCGAGAAAACCGCGTGCCGGTTTCGCAGCGGCCAGGACGTGACGCTCTATCCG
CTCGAGATCGCCGACGCGCGGCTGACGGGGATTCCGCCGGACATCCCGGCGCTCGACCGCTACGTGCCGG
CCGGCGCGCAGGTGCGCGGCGCGCTGCGCCTGCGGCTGCGCACGACCGGCAACATGCGCATCGCCGATCT
GCGGGGCCTCGACAGGCTGCCGCTGTATCTCGCGGGCGACGCTCAGGTGGCCTCGCACCTGTTCGAGCTG
CTGCACGTGGCCGGCGTCGCGACGCTCACGGCCGCGCCCGGCGAGTTCGCCGCGCCGGGCCGCCCGCCCG
CGGCGGTTACCGTCGACGCGCTCGCTCACGAAGGGCTCGGCGCCGACGAGGGGCTGTTGCCGCTCACGTG
GGCGAAGTTCCATGGGCACAACCTGCTGCACGAATACTTCGCGTGCCCGGAGCGCTTCTATTTCGTCGCG
CTGACGGGGCTCGAGGAAGGGTTGCGGCGCATCGCGGGCAGCGAGGTCGAAATCGTCGTGCTGCTCGAAC
AATCGCCCGAGCGGCTCGCGGACGTCGTCGACGCGTCGCGCTTCGCGCTGTTCTGCACGCCGGTGATCAA
CCTGTTTCCGCGCCACATGGACCGGATCGAACTGTCGAGCGGGCAGACCGAATGCCATCTGGTGCCGGCC
CGCCTCGCGCCGCTCGACTACGAAGTATTTTCCGTCGAGGCGATGTACGGGCAGGTCGCCGCGACATCGG
CCGAACTCGAGTTCCGGCCGCTGTACCAGACGCTGAACGACGACGAGAGCAACTATGGACGCTATTTCTC
GACGCGGCGCGAGCGCCGGCTCGTGTCGGATTTCGCGCGCCGCTACGGCACGCGCACGCCGTACGTCGGC
ACGGAGATGTTCGTATCGCTCGTCGATCAGAACGAGGCGCCCTACAGCGAGGACATCCGCTATCTGTCGG
TGGACGCGCTGGTGACGAACCGCGACCTGCCGAGCCTCGTGCCGCGCGACGGCGTGCGCGACCTCACGGC
GATCGAATCCGCGCCGATCGACAGCGTCGGCCTGATCCGCGCGCCGTCCGCGCCGAAGGCGCCGTATGCG
GAGCGCGAGATCGCGTGGCGGCTGATCCGCCAGTTGAACTTCAACTATCTGCCGCTCGACGAGCTCGACC
ATCGCGCGGGCGGACAGGGCCTGCGCGGCCTGCTGCGGCTGTTTCTGGCGGGCGACGAGGCCGACAGCCG
GCGGCAGGTGGAAAGCCTTGTCGGCGTGAAGACGCGGCCCGTCACGCGCAAGCTGCCCGGCGCGGGCCCG
CTCGTGTTCGGGCGCGGCGTCGAGTGCGCGCTGAGCGTCGACGAAACGGGCTTCTCCGGTGTGAGCCCGT
ATCTGTTCGGGCTCGTGCTCGAGCATTATCTGGCGCGGCACGTGTCGATCAACGTGTTCACGCAGACCGA
GCTGAACTCGATCCAGCGCGGCCGCATCGCGCGCTGGCCGGTGCGCATGGGCGCGCGGGGAGGCGCGTGA
 Primer design