SecReT6
Protein ID: 126456800
SecReT6 ID186
T6SS typei3
Gene symbol-
Locus tagBURPS1106A_A0242
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]229207..230706 [-]
Producthypothetical protein
NoteTssC
UniProt IDA3P1S5
KEGG IDbpl:BURPS1106A_A0242
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 6.00E-192, Aligned region: 67..493
Protein Sequence: 499 a.a.     [Download]
>gi|126456800|ref|YP_001074285.1| hypothetical protein BURPS1106A_A0242 [Burkholderia pseudomallei 1106a]
MKKQQAQTAAAGVQPQADSDFAQLLAQEFKPKTEQAREAVEYAVRTLAEQALAQSATISDDAYKSIAAII
AQIDHKLSEQINLILHHADFQKLESAWRGLHHLVSNTETDERLKIRFMDISKEELRRTMRRYKGQSWDQS
PLFKQIYEEEYGQLGGEPYGCLVADYYFDHTPPDVDLLGSISKVAASAHTPFISGASPSVLQMESWQELA
NPRDLTKIFTQNLEYASWNALRNMDDARYIGLAMPRFLSRLPYGVLTNPVDEFDFEEDTNGADHRRYAWT
NAAYAMGVNINRSFRLYGWCSLIRGVESGGTVENLPCHTFPTDDGGIDIKCPTEIAISDRREAELSKNGF
IPLVHRKNTDHATFIGAQSLHKPAEYDDSDATANANLSARLPYLFACSRFAHYLKCIVRDKVGAFKERED
MQRWLNEWIMNYVDADPANSSQDTKARRPLAAAEVVVEQAQGNPGYYQAKFFLRPHFQLEGLTVSLRLVA
KLPSIKEAA
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|126455463|ref|NC_009078.1|:c230706-229207 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGAAGAAACAGCAAGCCCAGACGGCCGCCGCCGGCGTCCAGCCGCAAGCGGATTCGGATTTCGCGCAGT
TGCTCGCGCAGGAGTTCAAGCCGAAGACGGAGCAGGCGCGCGAAGCGGTCGAATACGCGGTGCGCACGCT
CGCCGAGCAGGCGCTCGCGCAATCGGCGACGATCAGCGACGATGCATACAAGAGCATCGCCGCGATCATC
GCGCAGATCGACCATAAGCTATCCGAACAGATCAACCTGATCCTCCATCACGCGGATTTCCAGAAGCTCG
AATCGGCGTGGCGCGGGCTGCATCACCTGGTGTCGAACACCGAGACCGACGAGCGTCTGAAGATCCGCTT
CATGGACATCTCGAAGGAAGAGCTGCGCCGCACGATGCGGCGCTACAAGGGACAATCGTGGGACCAGAGC
CCGCTCTTCAAGCAGATCTACGAGGAGGAGTACGGGCAGCTCGGCGGCGAGCCGTACGGCTGCCTCGTCG
CCGATTACTACTTCGACCACACGCCGCCCGACGTCGACCTGCTCGGCTCGATCTCGAAGGTGGCCGCGTC
CGCGCACACGCCGTTCATCTCCGGCGCGTCGCCTTCGGTGCTGCAGATGGAATCGTGGCAGGAGCTCGCG
AACCCGCGCGACCTGACGAAGATCTTCACGCAAAACCTCGAATACGCGTCATGGAACGCGCTGCGCAACA
TGGACGACGCGCGCTACATCGGCCTCGCGATGCCGCGCTTCCTGTCGCGCCTGCCGTACGGCGTGCTGAC
GAATCCCGTCGACGAGTTCGACTTCGAGGAAGACACGAACGGCGCCGACCATCGCCGCTACGCGTGGACG
AACGCCGCCTACGCGATGGGCGTGAACATCAACCGGTCGTTCCGGCTCTACGGCTGGTGCTCGCTCATTC
GCGGCGTCGAATCGGGCGGCACGGTCGAGAACCTGCCGTGCCATACGTTCCCGACCGACGACGGCGGCAT
CGACATCAAATGCCCAACCGAGATCGCGATCTCGGACCGGCGCGAGGCGGAGCTGTCGAAGAACGGCTTC
ATTCCGCTCGTGCACCGCAAGAACACCGATCACGCGACGTTCATCGGCGCGCAATCGCTGCACAAGCCGG
CCGAATACGACGATTCCGACGCGACGGCCAACGCGAATCTGTCGGCGCGCCTGCCGTATCTGTTCGCATG
CTCGCGCTTCGCGCACTACCTGAAGTGCATCGTGCGCGACAAGGTGGGCGCCTTCAAGGAGCGCGAGGAC
ATGCAGCGCTGGCTGAACGAATGGATCATGAACTACGTCGACGCGGACCCGGCGAACTCGTCGCAGGACA
CGAAGGCGCGCCGGCCGCTCGCGGCCGCCGAGGTGGTCGTCGAGCAGGCGCAGGGCAACCCCGGCTACTA
CCAGGCGAAGTTCTTCCTGCGGCCGCATTTCCAGCTCGAGGGCCTGACCGTGTCGCTGCGGCTCGTCGCG
AAGCTGCCGTCGATCAAGGAAGCCGCCTGA
 Primer design