SecReT6
Protein ID: 126457249
SecReT6 ID186
T6SS typei3
Gene symbol-
Locus tagBURPS1106A_A0238
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]226627..227973 [-]
Producthypothetical protein
NoteTssK
UniProt IDA3P1S1
KEGG IDbpl:BURPS1106A_A0238
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.30E-144, Aligned region: 20..447
Protein Sequence: 448 a.a.     [Download]
>gi|126457249|ref|YP_001074281.1| hypothetical protein BURPS1106A_A0238 [Burkholderia pseudomallei 1106a]
MSWHNKVVWSEGLFMRPQLFQQQERYLEHYAHKRAAPLSPFFFGFSHFSLDSEAPALGKIIVKSASGVFA
DGTPFDAPGSTPPPAPLTIRPEHLDQVIYLAVPIRVPNGEETAFDRAAESLARYAVFETDLRDTNSIGQG
PKTVQLSNLRLRLLPEKELTDAWIGLALTRVKTIRADASIELDDMLIPPVVGYGASDTLASWLAKIHDLT
RLRANALAERLTGSDGRAGTTAEVSDYLLLQTLNRYEPLLKHLQRVPTTSPAELYALLIGMAGELSTYVR
TDTRRPLDTHPPYQHVAPHLCLKPVVDDTHRLLNAVLVRSAQRLALADLGHGMLNAVVDPVDMQGFTAVV
LAVHAQMPPDLLQQQFAAQAKAGPSERLPDLVRSHLSGIALQTLPVPPRQIPFNAGYVYYELARGGPLWD
EVAQHGGLALHIAGEFPSLKLELWGIRG
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|126455463|ref|NC_009078.1|:c227973-226627 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGAGCTGGCATAACAAGGTCGTCTGGAGCGAGGGGCTTTTCATGCGCCCGCAGCTGTTCCAGCAGCAGG
AGCGCTATCTCGAGCACTACGCGCACAAGCGCGCGGCGCCGCTGTCGCCGTTCTTCTTCGGCTTCAGCCA
CTTCAGCCTCGACAGCGAGGCGCCGGCGCTCGGCAAGATCATCGTGAAATCGGCGAGCGGCGTGTTCGCC
GACGGCACGCCGTTCGACGCGCCGGGCAGCACGCCGCCGCCCGCGCCGCTCACGATCCGGCCCGAGCATC
TGGACCAGGTGATCTACCTCGCGGTGCCGATCCGCGTGCCGAACGGCGAGGAAACCGCATTCGACCGCGC
GGCCGAATCGCTCGCGCGCTATGCCGTGTTCGAAACCGACCTGCGCGACACGAACTCGATCGGGCAAGGG
CCGAAGACGGTCCAGTTGTCGAACCTGCGCCTGCGGCTGCTTCCGGAAAAGGAACTGACGGACGCGTGGA
TCGGGCTCGCGCTCACGCGCGTGAAGACGATTCGCGCGGACGCGAGCATCGAGCTCGACGACATGCTGAT
TCCGCCCGTGGTCGGCTACGGCGCGAGCGACACGCTCGCGAGCTGGCTCGCGAAGATCCACGATCTCACG
CGCCTGCGCGCGAACGCGCTCGCCGAGCGCCTGACGGGCTCGGACGGCCGGGCGGGCACGACGGCCGAAG
TATCCGACTACCTGCTGCTGCAAACGCTCAATCGCTACGAGCCGCTGCTGAAACACCTGCAGCGCGTGCC
CACGACGTCGCCCGCCGAGCTGTACGCGCTGCTCATCGGCATGGCGGGCGAGCTGTCCACCTACGTGCGC
ACCGATACGCGCCGGCCGCTCGATACGCACCCGCCCTATCAGCACGTCGCGCCGCATCTGTGCCTGAAGC
CCGTCGTCGACGACACGCACCGGCTGCTCAACGCCGTGCTCGTGCGCAGCGCGCAGCGCCTCGCGCTCGC
CGATCTGGGGCACGGAATGCTCAACGCGGTCGTCGATCCGGTCGACATGCAGGGCTTCACCGCGGTCGTG
CTCGCGGTGCATGCGCAGATGCCGCCCGATCTGCTGCAGCAGCAGTTCGCCGCGCAGGCGAAGGCGGGGC
CGTCCGAGCGGCTGCCGGACCTCGTGCGCAGCCATCTGTCCGGCATCGCGCTGCAGACGCTGCCGGTGCC
GCCCCGGCAGATCCCGTTCAACGCCGGCTACGTCTATTACGAGCTCGCGCGCGGCGGGCCGCTGTGGGAC
GAAGTCGCGCAGCACGGCGGGCTCGCGCTGCACATCGCCGGCGAATTTCCGTCGCTGAAGCTCGAGCTAT
GGGGCATTCGCGGATAG
 Primer design