SecReT6
Protein ID: 126457252
SecReT6 ID187
T6SS typei3
Gene symbol-
Locus tagBURPS1106A_A0717
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]705979..709482 [+]
Producthypothetical protein
NoteTssM
UniProt IDA3P343
KEGG IDbpl:BURPS1106A_A0717
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.80E-69, Aligned region: 493..799
IcmF-related [PF06761], Evalue: 2.80E-69, Aligned region: 867..880
ImcF-related_N [PF14331], Evalue: 2.90E-29, Aligned region: 188..377
DUF1215 [PF06744], Evalue: 1.50E-27, Aligned region: 80..99
DUF1215 [PF06744], Evalue: 1.50E-27, Aligned region: 300..318
DUF1215 [PF06744], Evalue: 1.50E-27, Aligned region: 904..1029
Protein Sequence: 1167 a.a.     [Download]
>gi|126457252|ref|YP_001074753.1| hypothetical protein BURPS1106A_A0717 [Burkholderia pseudomallei 1106a]
MIRTSLRVFAAILIAILIWWVGPLFAFGIYHPLGPVWVREILVALVLIWGFWPTLARLWARLAMSPRQVK
VAPKAKQLDFVDKHLRTLDQQLKERWRKEPRGRWKRWVGALTREHRTMLPWYLVLGSEGSGKSSLVAKAV
SVSGSLQDRVLGSDATYGRGDDLNFRITREAVWFDVGGRWSLRAGADEAEFDAWRKLLRGMRRLRRGAPI
SGVVLCVDGLEMIDAPLDARKRLADSVRARLEEMREAFGQQVQVYVALNGLDRLDGAVSTLSLLEASKWV
KGVGFSLPDDGAHADAARADASWQHALQGLQQRVQQQVLYSAPAATEVSMNHAQLRFVETLSRLQKALVA
WLHVALAPGEPHTAARLRGVWLGSMAELAEPHPAGAGGVGSAELPVPSRPLSELWTPLIRQVALERDAVR
PSGPKSWRGRLGEALRWGAVPLVALSLLLWFGWGYVTERDYLDGVWAQFTEAKRLAQAEASYGNDGGSTL
IEIANQMRYAQLQAEDAAQGMATPYFEHGLVAETARETYYRHLQKMLMPELYNEVRRTLVSQVDGSPGDI
YQTLKVYLMLCRPARRSADDVVRWLDGRWDALSGGQYSDDDRRSLLAHVRTLMSLKEVPATPEDANLVRS
ARAKAAQIPLVTRVLQHIHAQGLPQQVNDISLSRAAGFEASMSLRMRSNVPSTDTAVSGWFTRAGYTDVF
LPRLQKSARAMLEEESWVLRDETLSGNSFQIDGLVQKLADSARNQFLQDYISAWQNFLNDVTVRGVTGLD
DASQLAAAMMEAQSPLANLLRFAARETTLTGASDEGNIDSWIDRQKYRFEKGRRQVVGELSGQHYRTVLL
PEHVVEEHFQAIRQLAAQLNRNNTIANNPLSRLFEPLYRQLGLVNGALQAGQVLPAQYDAFSRLKETAAR
QPEPVRGIMLDLVSSGSTMTTRESGALLNRGAAGATKMVCDQGFTGRYPMRRGAQADAGVEDFERLFSAQ
GLMATYFRDHLAAYVDTSAKPWQALRSNGGPNGMVSQSVLNSYETAERIRGAMLDDSGHLRVSTVLRFID
MDSQLSEAQLSVAGQTVRFAHGVTSPHRVDWTNQNTQLAIKLQLKSVDGRMTTLQFDGPWALFRFFDAGQ
AVGGTGTADRRERLYQTSLGTVRIEWQALTLPSPIWSGILQSFRCPS
 
Nucleotide Sequence: 3504 bp     [Download]
>gi|126455463|ref|NC_009078.1|:705979-709482 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGATCCGCACGAGCTTGAGAGTATTCGCGGCGATTCTGATCGCGATCCTGATCTGGTGGGTGGGGCCGC
TGTTCGCGTTCGGCATCTATCACCCGCTCGGCCCGGTGTGGGTGCGCGAGATCCTCGTCGCACTGGTGCT
GATCTGGGGCTTCTGGCCGACGCTCGCGCGGCTCTGGGCGCGGCTCGCGATGAGCCCGCGGCAGGTGAAG
GTCGCGCCGAAGGCCAAGCAGCTCGATTTCGTCGATAAGCATCTGCGCACCCTCGACCAGCAGTTGAAGG
AGCGCTGGCGCAAGGAGCCGCGCGGCCGCTGGAAGCGCTGGGTCGGCGCGCTCACGCGCGAGCATCGCAC
GATGCTGCCGTGGTATCTGGTGCTCGGCTCCGAGGGTAGCGGCAAGTCGAGCCTCGTCGCGAAGGCGGTG
AGCGTGTCCGGCTCGCTGCAGGACCGGGTGCTCGGCTCGGACGCGACCTACGGGCGCGGCGACGACTTGA
ACTTCCGCATCACGCGCGAGGCGGTGTGGTTCGACGTCGGCGGCCGCTGGAGCCTGCGCGCGGGCGCGGA
CGAGGCCGAGTTCGACGCGTGGCGCAAGCTGCTGCGCGGGATGAGGCGGCTGCGCAGGGGCGCGCCGATC
AGCGGCGTCGTGCTGTGCGTCGACGGCCTCGAGATGATCGATGCGCCGCTCGACGCGCGCAAGCGGCTGG
CCGATTCGGTGCGCGCGCGGCTCGAGGAGATGCGCGAGGCGTTCGGCCAGCAGGTGCAGGTGTACGTTGC
GCTGAACGGGCTCGACCGGCTCGACGGCGCGGTCTCGACGCTGTCGCTGCTCGAGGCGTCGAAGTGGGTC
AAGGGCGTGGGCTTCAGCCTGCCCGACGACGGCGCGCACGCCGACGCCGCGCGCGCGGACGCGAGCTGGC
AGCACGCGCTGCAAGGGCTGCAGCAGCGGGTCCAGCAGCAGGTGCTGTATTCGGCGCCGGCGGCGACCGA
GGTGTCGATGAACCACGCGCAGTTGCGCTTCGTCGAGACGCTCAGCCGCCTGCAGAAGGCGCTCGTCGCG
TGGCTGCACGTCGCGCTCGCGCCGGGCGAGCCGCACACGGCCGCGCGGCTGCGCGGGGTGTGGCTGGGCT
CGATGGCCGAGCTCGCGGAGCCGCATCCGGCGGGCGCGGGCGGCGTCGGCTCGGCGGAGCTGCCCGTGCC
GTCGCGCCCGCTCAGCGAGCTGTGGACGCCGCTCATCCGGCAGGTGGCGCTCGAGCGCGACGCGGTGCGC
CCGAGCGGGCCGAAGTCGTGGCGCGGGCGCCTGGGCGAGGCGCTGCGCTGGGGCGCGGTGCCCCTCGTCG
CGCTGAGCCTGCTGCTGTGGTTCGGCTGGGGCTACGTCACCGAGCGCGACTATCTGGACGGCGTCTGGGC
GCAGTTCACCGAGGCCAAGCGGCTCGCGCAGGCCGAGGCGTCCTACGGCAACGACGGCGGCTCGACGCTC
ATCGAGATCGCGAACCAGATGCGCTATGCGCAACTGCAGGCCGAGGACGCCGCGCAGGGCATGGCGACGC
CGTACTTCGAGCACGGGCTCGTCGCGGAAACCGCGCGCGAGACCTACTACCGGCACTTGCAGAAGATGCT
GATGCCGGAGCTGTACAACGAGGTGCGGCGCACGCTCGTGTCGCAGGTCGACGGCAGCCCGGGCGACATC
TACCAGACGCTGAAGGTCTACCTGATGCTCTGCCGCCCCGCGCGGCGCTCGGCGGACGACGTCGTGCGCT
GGCTCGACGGCCGCTGGGACGCGCTCTCGGGCGGGCAGTACTCGGACGACGACCGCCGCTCGCTGCTCGC
GCACGTGCGCACGCTGATGTCGCTGAAGGAGGTGCCGGCCACGCCGGAGGACGCGAACCTCGTGCGCTCG
GCGCGCGCGAAGGCCGCGCAGATCCCGCTCGTCACGCGCGTGCTGCAGCACATCCACGCGCAGGGGCTGC
CGCAGCAGGTCAACGACATTTCGCTGTCGCGCGCGGCGGGCTTCGAGGCGTCGATGAGCCTGCGCATGCG
CAGCAACGTGCCGTCGACCGACACCGCGGTGTCGGGCTGGTTCACGCGCGCGGGCTACACGGACGTGTTC
CTGCCGCGCCTGCAGAAGAGCGCGCGCGCGATGCTCGAGGAGGAGAGCTGGGTGCTGCGCGACGAGACGC
TGTCGGGCAACAGCTTCCAGATCGACGGACTCGTGCAGAAGCTCGCCGATTCGGCGCGCAACCAGTTCCT
GCAGGACTACATCTCCGCGTGGCAGAACTTCCTGAACGACGTGACGGTGCGCGGCGTGACGGGCCTGGAC
GATGCGTCGCAGCTCGCCGCGGCGATGATGGAGGCGCAATCGCCGCTCGCGAACCTGCTGCGCTTCGCCG
CGCGCGAGACGACGCTCACGGGCGCGAGCGACGAAGGCAACATCGACAGCTGGATCGATCGCCAGAAGTA
CCGCTTCGAGAAGGGGCGGCGGCAGGTCGTCGGCGAGCTGAGCGGGCAGCATTACCGCACGGTGCTGCTG
CCGGAGCACGTGGTCGAGGAGCACTTCCAGGCGATCCGCCAGCTCGCCGCGCAACTGAACCGCAACAACA
CGATCGCGAACAACCCGCTGTCGCGGCTGTTCGAGCCGCTGTACCGGCAGCTCGGGCTCGTCAACGGCGC
GCTGCAGGCGGGCCAGGTGCTGCCCGCGCAGTACGACGCGTTCTCACGGCTGAAGGAGACGGCCGCGCGC
CAGCCGGAGCCGGTGCGCGGGATCATGCTCGACCTCGTGAGCAGCGGCAGCACGATGACGACGCGCGAAT
CGGGCGCGCTGCTCAACCGGGGCGCGGCGGGCGCGACGAAGATGGTCTGCGATCAGGGCTTCACGGGCCG
CTATCCGATGCGCCGCGGCGCGCAGGCGGATGCGGGCGTGGAGGACTTCGAGCGGCTGTTCAGCGCGCAG
GGGCTGATGGCGACGTACTTCCGCGATCACCTCGCCGCGTATGTGGACACGTCGGCCAAGCCGTGGCAGG
CGCTGCGCTCGAACGGCGGGCCGAACGGGATGGTGAGCCAGTCGGTGCTGAACTCGTACGAGACGGCCGA
GCGCATCCGCGGCGCGATGCTCGACGATTCGGGGCACCTGCGCGTGTCGACCGTGCTGCGTTTCATCGAC
ATGGATTCGCAGTTGTCCGAAGCGCAGCTGAGCGTGGCTGGGCAGACGGTGCGCTTCGCGCACGGCGTGA
CCTCGCCGCACCGGGTGGACTGGACCAACCAGAACACGCAGCTCGCGATCAAGCTGCAGCTCAAATCGGT
GGACGGCCGGATGACGACGCTGCAGTTCGACGGGCCGTGGGCGCTGTTCCGCTTCTTCGACGCGGGGCAG
GCGGTGGGCGGCACGGGCACCGCGGACCGGCGCGAGCGGCTGTATCAGACGAGCCTCGGCACGGTGCGCA
TCGAATGGCAGGCGCTCACGCTGCCGTCGCCGATATGGTCGGGCATCCTGCAGTCGTTCAGGTGTCCGTC
GTGA
 Primer design