SecReT6
Protein ID: 126457863
SecReT6 ID186
T6SS typei3
Gene symbolsciM
Locus tagBURPS1106A_A0240
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]228605..229090 [-]
ProductSciM protein
NoteTssD
UniProt IDA3P1S4
KEGG IDbpl:BURPS1106A_A0240
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.40E-44, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|126457863|ref|YP_001074284.1| SciM protein [Burkholderia pseudomallei 1106a]
MAQDIFLKIDGINGESLDDSHKDEIEVLNWNWEIQQESTMHTGSGGGAGKASVKDLTFEHAIDRASPNLM
KYALTGKHVDQAVLVMRKAGGNPLEYLKLTMSDVIITRVRPSGSRDDTERSRETVSLSFAKVKQEYVVQN
AQGGSGGAVTTSFDIKGNKEA
 
Nucleotide Sequence: 486 bp     [Download]
>gi|126455463|ref|NC_009078.1|:c229090-228605 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGGCGCAGGATATTTTTCTGAAGATCGACGGCATCAACGGTGAATCCCTCGACGACAGCCACAAGGACG
AGATCGAAGTCCTGAACTGGAACTGGGAGATTCAGCAGGAATCGACGATGCACACGGGCAGCGGCGGCGG
CGCCGGCAAGGCGAGCGTGAAGGATCTGACGTTCGAGCACGCGATCGACCGCGCGAGCCCCAACCTGATG
AAGTACGCGCTGACCGGCAAGCACGTCGATCAGGCGGTGCTCGTGATGCGCAAGGCGGGCGGCAATCCGC
TCGAATACCTGAAGCTCACGATGAGCGACGTGATCATCACGCGCGTGCGGCCGTCGGGCAGCCGCGACGA
CACCGAGCGCAGCCGCGAGACGGTATCGCTGTCGTTCGCGAAGGTGAAGCAGGAGTATGTCGTGCAGAAC
GCGCAGGGCGGCAGCGGCGGCGCCGTCACGACGAGCTTCGACATCAAGGGCAACAAGGAAGCCTGA
 Primer design