SecReT6
Protein ID: 126457982
SecReT6 ID185
T6SS typei3
Gene symbol-
Locus tagBURPS1106A_A0140
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]123803..127711 [+]
ProductImcF/SciS family protein
NoteTssM
UniProt IDA3P1H3
KEGG IDbpl:BURPS1106A_A0140
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.30E-97, Aligned region: 42..57
ImcF-related_N [PF14331], Evalue: 1.30E-97, Aligned region: 264..541
IcmF-related [PF06761], Evalue: 2.50E-91, Aligned region: 393..495
IcmF-related [PF06761], Evalue: 2.50E-91, Aligned region: 590..913
DUF1215 [PF06744], Evalue: 3.10E-33, Aligned region: 1036..1159
Protein Sequence: 1302 a.a.     [Download]
>gi|126457982|ref|YP_001074183.1| ImcF/SciS family protein [Burkholderia pseudomallei 1106a]
MSYLKRFLRFVFSWQMLACIAVLLVCAAVWFVGPLLAFDELRPLAGVVVRVAVIVLLVALLAFWLLRWPL
SPIGVAALCLLIWHAGPLFAFGDHRPFGPAWVRVLIVAAMLFCYAVYGLYRLWQAVRTNDALLKRILEPS
AGKPDAAAQANIRAVSVAVSKAIGQLKRLRGGAFGWRRLLESGRYLYELPWYMVVGAPGAGKSAAIARSG
LKFPLADQMEASSERARGGTANCEWWFANEAVLIDTAGRYVRHEVPGDEEATVANGAEWKGFLGLLRKHR
PRAPVNGVVLSVSVEELVGRTPAERTAHAATLRARLGELHQELGIHFPVYVIVTKLDLLPGFPEYFQSLT
AEGRTQIWGFTLPYDAENRRSAVGALREHCADELKRLEMRIDAGLNNRLLEEYENDRRKRLYALPQEFRS
LSAALSDMLALVFLDSRYDDAQLQNTLRGVYFTSAEQTDQVLAADRETILQRLKRQLGRMLGGDAGAQTR
DSGAVSGSRGYFLRDVFQHVIVPEAHLVRPNVRWEVRFRLMRWAGHLLAVALLVWLASALTVSFDNNRGY
LDAISEKTAALAARVNAYNKAPKPAQIGGVLDGARDLPQHGNLDLDAPGASFRYGLYVAPGIVDASDATY
RSLLRRSLLPQIVRRVEDALSAQIDAKHADEVYRTLTVYLMLDDAARHDAKAVKDWVMRDWERSDSAAEM
GGRNLMARHLDALFVDARPFEPSGHRNAALVQRARLFLNANPAPRRLYERAMAAIEKEAPENFTLARAVG
LQGAGIFRLADGSRFQRGMPGLYTYDGYHQVFSARLPEFLARAQSDDAWVMGNAGPAARWGDAIRNTQAV
AGRSSLADDIRRQYLTDYGNYWQQYLADIRPASSGEDGAGGTLAFDLATLRALAAPDSPLVRLARAVVRE
TSLSVVDAREDASLTDAALSSLGRRSGAAKEVADGAQKLAARRPEQRLEKELVDNRFAALREVVTGQADT
GSGPAMTDVPVAAGGRALQLDAILTLINEQYTRLVVADNALSSQSMPPALDIGTTLQMEAEKLPAPLRTV
LGGIATQAADKVGREVGSLLAMQVDSSVGNACRAAVDGKYPFARSAQEVDIEDFNRLFAAGGLFDAFFQK
ALAPHVDTHSKPWRYKALNPGMPPIRGPSLEPFERAAAIRDVFFREPGAKRMAWRMDAKVASIDPEITEL
IVDVDGQSQRYVHGPVLPFSVNWPGPRGGAIAEITAKPRIRPDTSTIATTGPWALFRLIERGRLTGTTSA
SRLMLDFDFDGRHAALELRTNGQMNPLTSGLLTHFRCPGSVG
 
Nucleotide Sequence: 3909 bp     [Download]
>gi|126455463|ref|NC_009078.1|:123803-127711 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGTCTTACCTGAAACGCTTCTTGAGATTCGTCTTTTCGTGGCAGATGCTCGCATGCATCGCGGTGCTGC
TTGTTTGCGCCGCCGTATGGTTCGTCGGCCCCCTGCTCGCGTTCGACGAGTTGCGGCCGCTCGCGGGCGT
CGTCGTGCGGGTCGCCGTCATCGTCCTTCTCGTGGCGCTCCTTGCGTTCTGGCTGTTGCGCTGGCCGCTC
AGCCCGATCGGCGTCGCCGCACTGTGTCTGCTGATCTGGCACGCGGGGCCGCTCTTCGCGTTCGGCGATC
ACCGCCCGTTCGGGCCCGCGTGGGTCCGCGTGCTGATCGTCGCCGCGATGCTCTTCTGCTACGCCGTGTA
TGGTCTCTATCGCCTGTGGCAGGCGGTTCGGACGAACGACGCATTGCTCAAGCGCATTCTCGAGCCGTCG
GCGGGCAAGCCGGACGCGGCGGCCCAGGCGAACATCCGTGCGGTGAGCGTGGCGGTGTCGAAGGCGATCG
GTCAACTGAAGCGCTTGCGCGGCGGTGCGTTCGGCTGGCGGCGCTTGCTCGAAAGCGGGCGCTACCTGTA
TGAACTGCCGTGGTACATGGTGGTCGGCGCGCCTGGTGCGGGCAAGAGCGCGGCGATCGCGCGTTCCGGC
CTGAAGTTTCCGCTCGCGGATCAGATGGAGGCATCGTCCGAGCGCGCGCGGGGCGGCACGGCCAATTGCG
AATGGTGGTTCGCCAACGAGGCCGTGTTGATCGACACGGCGGGCCGTTACGTGCGGCACGAGGTGCCCGG
CGACGAAGAGGCGACAGTTGCCAACGGGGCGGAGTGGAAGGGCTTTCTCGGTCTGCTTCGCAAACATCGG
CCGCGCGCGCCGGTCAATGGCGTGGTCCTGTCGGTCAGCGTCGAGGAGCTCGTCGGGCGCACGCCGGCCG
AGCGCACCGCGCACGCAGCCACGCTGCGCGCCCGCCTGGGCGAGTTGCATCAGGAACTGGGCATTCATTT
CCCGGTATACGTGATCGTCACGAAACTCGATTTGCTGCCCGGCTTTCCGGAGTATTTCCAGTCGTTGACG
GCCGAAGGGCGGACGCAGATCTGGGGATTCACGCTGCCCTACGACGCGGAGAACAGGCGGAGCGCGGTCG
GCGCGCTGCGCGAGCATTGCGCCGACGAGCTGAAGCGGCTGGAGATGCGTATCGACGCGGGGCTGAACAA
CCGTCTGCTCGAAGAGTACGAAAACGATCGCCGCAAGCGGCTGTATGCGTTGCCGCAGGAGTTCCGGAGC
CTGTCGGCCGCGCTGTCGGACATGCTCGCCCTCGTGTTTCTCGATTCACGCTACGACGACGCCCAGTTGC
AGAACACGCTGCGCGGCGTCTACTTCACGAGCGCCGAGCAGACGGATCAGGTATTGGCCGCGGATCGCGA
AACCATCCTGCAGCGCTTGAAGCGCCAACTCGGCAGAATGCTCGGCGGCGATGCCGGCGCGCAGACGCGT
GACAGCGGCGCGGTGTCGGGCAGCCGCGGCTACTTCCTGCGCGATGTGTTCCAGCATGTGATCGTGCCGG
AGGCGCATCTGGTTCGGCCGAACGTCAGGTGGGAGGTGCGTTTTCGCCTGATGCGCTGGGCCGGGCATCT
GCTCGCCGTCGCATTGCTGGTCTGGCTGGCGAGCGCGCTGACGGTGAGCTTCGACAACAATCGCGGTTAC
CTGGACGCGATCTCGGAAAAGACAGCCGCGCTCGCCGCACGAGTCAACGCGTACAACAAGGCGCCGAAGC
CGGCGCAGATCGGGGGCGTACTGGATGGCGCGCGCGATCTTCCTCAGCATGGCAATCTCGATCTCGACGC
GCCCGGCGCGAGCTTCCGCTACGGCCTGTATGTCGCACCCGGCATCGTCGACGCGTCCGACGCGACTTAT
CGGAGCCTGCTGCGCCGGAGCCTTCTGCCGCAGATCGTGCGGCGCGTCGAAGATGCACTGAGCGCGCAAA
TCGATGCGAAGCATGCGGACGAGGTCTATCGCACGCTGACGGTCTACTTGATGCTCGACGACGCCGCGCG
CCATGACGCGAAGGCGGTGAAAGACTGGGTCATGCGCGACTGGGAGCGCTCGGATAGCGCGGCCGAGATG
GGGGGGCGCAATTTGATGGCGCGGCACCTGGACGCGCTGTTCGTCGATGCTCGGCCTTTCGAGCCGAGCG
GGCACCGGAACGCCGCACTCGTTCAGCGCGCCCGGCTTTTCCTCAACGCGAACCCGGCCCCGAGGCGGCT
GTACGAGCGTGCGATGGCCGCGATCGAGAAGGAGGCGCCGGAGAACTTCACGCTCGCGCGTGCGGTCGGG
CTTCAGGGCGCGGGCATCTTTCGGCTCGCCGACGGCTCGCGGTTTCAACGCGGGATGCCCGGCTTGTATA
CGTACGATGGCTACCACCAGGTATTCAGCGCCCGGTTGCCCGAATTTCTCGCCCGTGCGCAAAGCGACGA
CGCATGGGTGATGGGGAACGCCGGCCCCGCCGCGCGATGGGGCGACGCGATTCGGAACACGCAGGCCGTT
GCGGGTCGGTCTTCGCTTGCCGACGACATTCGTCGCCAGTACCTGACGGATTACGGCAACTATTGGCAAC
AGTATCTGGCGGACATTCGGCCCGCGTCGTCCGGAGAGGACGGCGCGGGCGGCACGCTCGCATTCGATCT
CGCGACGCTGCGCGCGCTCGCCGCCCCCGATTCACCGCTCGTGAGACTGGCGCGCGCCGTCGTTCGCGAA
ACATCGCTGTCGGTCGTCGACGCACGGGAAGACGCGTCGTTGACCGACGCCGCGCTTTCGTCGCTCGGGC
GACGATCCGGCGCGGCGAAGGAGGTTGCCGACGGCGCGCAGAAACTGGCGGCGCGGCGGCCGGAGCAGCG
CCTCGAGAAGGAGCTGGTGGACAACCGCTTCGCGGCGCTGCGCGAGGTGGTGACGGGGCAGGCCGACACG
GGAAGCGGGCCGGCGATGACGGACGTGCCGGTCGCGGCGGGGGGCCGGGCGCTGCAGCTCGACGCGATCC
TCACGCTGATCAACGAACAGTACACGCGCCTCGTCGTTGCCGACAACGCGCTCTCCTCGCAGAGCATGCC
GCCCGCGCTGGACATCGGCACCACCTTGCAAATGGAGGCGGAGAAACTGCCCGCGCCGCTGCGCACGGTG
CTGGGCGGCATCGCGACGCAAGCCGCCGACAAAGTCGGGCGCGAAGTGGGTTCGCTGCTCGCGATGCAGG
TGGACTCGAGTGTCGGCAACGCGTGTCGCGCCGCCGTCGACGGCAAGTATCCGTTCGCGCGCAGCGCGCA
GGAAGTCGACATCGAGGATTTCAACCGCCTCTTCGCCGCGGGCGGCCTGTTCGACGCGTTTTTTCAGAAG
GCGCTCGCGCCGCATGTCGACACCCATTCGAAGCCGTGGCGTTACAAGGCGTTGAATCCCGGCATGCCGC
CGATCCGGGGGCCGAGCCTCGAGCCGTTCGAGCGCGCCGCCGCGATTCGCGACGTGTTCTTTCGTGAACC
GGGCGCAAAGCGGATGGCGTGGAGGATGGATGCGAAGGTGGCGTCGATCGACCCTGAGATCACCGAGCTC
ATCGTCGACGTCGACGGCCAGTCGCAGCGCTATGTCCACGGCCCCGTGCTGCCGTTCTCCGTGAACTGGC
CCGGGCCGCGCGGCGGCGCGATCGCCGAGATCACCGCGAAGCCGCGGATTCGTCCCGATACGTCGACGAT
CGCGACGACGGGGCCCTGGGCGCTGTTTCGGCTGATCGAGCGCGGGCGGTTGACGGGCACCACGTCGGCG
AGCCGGTTGATGCTGGATTTCGATTTCGACGGTCGGCACGCTGCCCTGGAGCTCAGGACGAACGGCCAGA
TGAATCCGTTGACGAGCGGCTTGCTGACGCATTTTCGCTGTCCGGGGAGCGTCGGTTGA
 Primer design