SecReT6
Protein ID: 126458165
SecReT6 ID188
T6SS typei1
Gene symbol-
Locus tagBURPS1106A_A2040
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]2012829..2016833 [+]
Producthypothetical protein
NoteTssM
UniProt IDA3P6W3
KEGG IDbpl:BURPS1106A_A2040
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.50E-48, Aligned region: 171..416
ImcF-related_N [PF14331], Evalue: 3.50E-48, Aligned region: 1093..1133
Protein Sequence: 1334 a.a.     [Download]
>gi|126458165|ref|YP_001076073.1| hypothetical protein BURPS1106A_A2040 [Burkholderia pseudomallei 1106a]
MMIARIAALLALAALSWASALYFDWPLWCAPAVFCAALAGWLLCRVARRALRAVRARAQLARLDASERLP
AADAPELRVAARWRTALAALGRAQPAPRLRGRPRDALPWYLVIGPEGAGKTTALARARLVSPLRHARDDA
AIAPTEDCDWWCFDDAVVLDLAGRFAAPGATDDDRRAWHALLEQLGRARARRGVNGVVVAIDAPRLIEAS
RDALTIEGSAIRERLEQLIRLFDRRFPVYVLVTQCDRLYGFDEWAAQLAPEQRERAFGYLGDHDADAFVA
RALDSLDARLGALRVALAARGEPPSPRALMLPHELACLRPALEAFARAAFGPNVYQETPYLRGLLFASGR
QAGGAPSLTLPDWLDAAPARTPGDAGLFLHDVFARVLPGERDAWLPVERPSRSRLVLRRLALAAWLLASI
AAGLLMSASFVGDMRTVELVRRDYPAHPRFTGEFAHDTATLERIGRVIADVERRDERRLVRPLAGATPVG
RLEAELKRRYVAHYRRSIEPTADRLFFGEPDGASDVRAADDARLAARIRNLVRYVNLMQARRRGADRETL
AQMPAPAVARATDGGGARGVDSVGVSGVSGVSGVSGVSGVSGVSGVSGGVGGVGGVGGARAAEGAGRAVR
ASGGRRAGDARAARGMRGAAGNAGAGAEIAPAADGVRDRDEGFARVSALAVDLIAWSAPDDRALAARVAA
AQAELERLAYRDPDGAWLLALPDASMPRDVTLADFWPAAEPRTLPDAQPAALRDVRVPAALTAAHRPAID
AFLDEMAQAVANRPKFAFHRDAFDTWYRARRIDAWRDFVARFPQGEQGLTTQAQWRAVIDRIADRRDPFA
ALLARVDREFESERDDTLPPWLRFVRTTSHMLAPAMLAPARLPAASGGLGAALGSISRSGGRALREALGG
APEQGRLTLERDAALRDALVDYERRVAALAADALAGPGAAYRLAADFHGFGVDPSVQASAMRAADSALRD
VKRLAGDRDVGGDVVWSLVGGPLRALIAYVERQASCALQDDWERDVLWPLRRAATRDDVEGLLYGPQGAI
WAFVDGPAKPFVRVGAARASALDTLGYRLPFTDAFLPLIDDAAARRVAQARRDAERRAQQQAALELDERI
ASLGKQIDALRAQTVRFGIVAQPTDVNPDAQAKPFETVLTLQCAPQARTLTNYNLRVSEQIDWQPDRCGD
ATLRISLGGVTLVRRYAGSLGVARFVQDFRYGVRRFTPRDFPDAKAQLQRLGVRHIDVRYDFSGHDALLA
HVGRIDALERARRDDLARQRRAANRQDDDAGGATAIARAAASVANAPGAALPRRIGVCWGDPAHDRPDGD
GAQP
 
Nucleotide Sequence: 4005 bp     [Download]
>gi|126455463|ref|NC_009078.1|:2012829-2016833 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGATGATCGCGCGGATCGCCGCGCTGCTCGCGCTCGCCGCGCTCAGTTGGGCGAGCGCGCTCTATTTCG
ACTGGCCGCTGTGGTGCGCGCCCGCCGTGTTCTGCGCGGCGCTCGCCGGATGGCTGCTGTGCCGCGTCGC
GCGCCGCGCGCTGCGCGCGGTTCGTGCGCGCGCGCAGCTCGCACGGCTCGACGCATCCGAGCGCCTGCCC
GCGGCCGACGCGCCGGAGCTGCGCGTCGCCGCGCGCTGGCGCACCGCGCTCGCCGCGCTCGGGCGCGCGC
AGCCCGCGCCGCGCCTGCGCGGCCGGCCGCGCGACGCGCTGCCGTGGTATCTCGTGATCGGCCCCGAGGG
CGCGGGCAAGACAACCGCGCTCGCACGCGCGCGCCTCGTGTCGCCGCTGCGGCACGCGCGCGACGACGCG
GCCATCGCGCCGACCGAGGACTGCGACTGGTGGTGCTTCGACGACGCGGTCGTGCTCGATCTCGCGGGCC
GCTTCGCCGCGCCCGGCGCGACCGACGACGATCGCCGCGCATGGCACGCGCTCCTCGAGCAGCTCGGCCG
CGCGCGTGCGCGCCGGGGCGTGAACGGCGTCGTGGTCGCGATCGACGCGCCGCGCCTCATCGAAGCGAGC
CGCGATGCGCTGACGATCGAAGGCAGCGCCATTCGCGAACGGCTCGAGCAACTGATCCGCCTGTTCGACC
GGCGCTTTCCGGTGTACGTGCTCGTCACGCAATGCGACCGGCTCTACGGCTTCGACGAATGGGCCGCGCA
GCTCGCGCCGGAACAACGCGAGCGCGCGTTCGGCTATCTCGGCGATCACGACGCGGATGCGTTCGTCGCG
CGCGCGCTCGACAGCCTCGACGCACGGCTCGGCGCACTGCGCGTCGCGCTGGCGGCGCGCGGCGAGCCGC
CGTCGCCGCGCGCGCTGATGCTGCCGCACGAACTCGCGTGCCTGCGGCCCGCGCTCGAGGCGTTCGCACG
CGCGGCGTTCGGCCCGAACGTCTATCAGGAAACACCGTATCTGCGCGGGCTGCTGTTCGCGAGCGGCCGG
CAGGCGGGCGGCGCGCCGTCGCTGACGCTGCCCGACTGGCTCGACGCCGCGCCGGCGCGCACGCCCGGCG
ATGCGGGCCTGTTCCTGCACGACGTGTTCGCGCGCGTGCTGCCGGGCGAGCGCGACGCGTGGCTGCCCGT
CGAGCGGCCGAGCCGCTCGCGGCTCGTGCTGCGGCGCCTCGCGCTCGCCGCGTGGCTCCTCGCGAGCATC
GCGGCCGGGCTGCTGATGAGCGCATCGTTCGTCGGCGACATGCGAACCGTCGAGCTGGTCCGCCGCGACT
ATCCCGCGCATCCGCGCTTCACCGGCGAATTCGCGCACGACACGGCGACGCTCGAGCGGATCGGCCGCGT
GATCGCCGACGTCGAGCGGCGCGACGAGCGGCGGCTCGTGCGCCCGCTCGCCGGCGCGACGCCCGTCGGC
CGGCTCGAAGCGGAACTCAAGCGCCGCTACGTCGCGCACTATCGGCGCTCGATCGAACCCACCGCCGATC
GGCTGTTCTTCGGCGAGCCGGACGGCGCGAGCGACGTGCGCGCGGCCGACGATGCGCGGCTCGCCGCGCG
CATCCGCAATCTGGTCCGCTACGTGAACCTGATGCAGGCGCGCCGGCGCGGCGCGGATCGCGAGACGCTC
GCGCAAATGCCCGCACCGGCGGTCGCGCGCGCGACGGATGGCGGTGGCGCTCGCGGAGTGGACAGTGTGG
GTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTC
TGGCGGTGTAGGCGGTGTAGGCGGTGTAGGCGGTGCGCGCGCCGCGGAAGGCGCGGGTCGCGCCGTCCGC
GCGAGCGGCGGACGGCGCGCAGGCGACGCGCGCGCCGCGCGCGGCATGCGCGGCGCCGCCGGCAACGCCG
GCGCCGGCGCTGAAATCGCACCCGCCGCAGACGGCGTTCGCGATCGCGACGAAGGGTTCGCGCGCGTCAG
CGCGCTCGCCGTCGACCTGATCGCGTGGAGCGCGCCCGACGATCGCGCGCTCGCCGCGCGCGTCGCGGCC
GCGCAGGCAGAGCTCGAACGGCTCGCGTACCGCGATCCGGACGGCGCGTGGCTGCTCGCGCTGCCGGATG
CCTCGATGCCGCGCGACGTGACGCTCGCCGATTTCTGGCCCGCCGCCGAGCCGCGCACGCTGCCCGACGC
ACAGCCCGCCGCGCTGCGCGACGTGCGCGTGCCCGCCGCGCTGACGGCCGCGCATCGCCCGGCCATCGAT
GCGTTCCTCGACGAGATGGCGCAGGCGGTCGCGAACCGGCCGAAGTTCGCGTTCCATCGCGACGCGTTCG
ACACGTGGTACCGCGCACGGCGCATCGACGCATGGCGCGACTTCGTCGCACGCTTCCCGCAGGGCGAGCA
AGGGCTGACGACGCAAGCGCAATGGCGCGCGGTGATCGACCGGATCGCCGATCGCCGCGATCCGTTCGCG
GCATTGCTCGCGCGCGTCGATCGCGAATTCGAATCCGAGCGCGACGACACGCTGCCGCCGTGGCTACGGT
TCGTGCGCACGACATCGCACATGCTCGCCCCCGCGATGCTCGCGCCCGCGCGCCTGCCCGCGGCGAGCGG
CGGCCTGGGCGCCGCGCTCGGCTCGATCTCGCGCAGCGGCGGACGCGCGCTGCGCGAAGCGCTCGGCGGC
GCGCCCGAGCAAGGCAGGCTCACGCTCGAGCGCGATGCCGCGCTGCGCGACGCGCTTGTCGACTACGAGC
GGCGCGTCGCCGCGCTCGCCGCCGATGCGCTTGCGGGCCCCGGCGCCGCGTACCGGCTCGCGGCCGATTT
CCACGGCTTCGGCGTCGATCCGTCCGTCCAGGCTTCCGCGATGCGCGCGGCCGACAGCGCGCTGCGCGAC
GTCAAGCGGCTCGCGGGCGATCGCGACGTCGGCGGCGACGTCGTCTGGAGCCTCGTCGGCGGCCCGCTGC
GCGCGCTGATCGCGTATGTCGAGCGGCAGGCGTCGTGCGCGCTGCAGGACGACTGGGAGCGCGACGTGCT
GTGGCCGCTCAGGCGCGCGGCGACGCGCGACGACGTGGAGGGTCTGCTGTACGGCCCGCAAGGCGCGATC
TGGGCGTTCGTCGACGGCCCGGCGAAGCCGTTCGTGCGTGTCGGCGCGGCGCGTGCATCGGCGCTCGACA
CGCTCGGCTACCGGCTGCCGTTCACCGACGCGTTCCTGCCGCTCATCGACGACGCGGCCGCCCGGCGCGT
CGCGCAAGCGCGGCGCGACGCCGAGCGGCGCGCGCAACAGCAGGCGGCGCTCGAGCTGGACGAGCGGATC
GCATCGCTCGGCAAGCAGATCGACGCGCTGCGCGCGCAAACGGTGCGCTTCGGGATCGTCGCGCAGCCGA
CCGACGTGAACCCGGATGCGCAGGCCAAGCCGTTCGAAACCGTGCTGACGCTGCAATGCGCGCCGCAGGC
GCGCACGCTGACGAACTACAACCTGCGCGTGTCCGAGCAGATCGACTGGCAACCCGATCGATGCGGCGAC
GCGACGCTGCGCATCTCGCTCGGCGGCGTCACGCTCGTGCGCCGTTACGCGGGATCGCTCGGCGTCGCGC
GCTTCGTCCAGGACTTCCGCTACGGCGTGCGCCGCTTCACGCCCCGCGATTTCCCGGACGCGAAAGCGCA
GCTTCAACGTCTCGGCGTGCGCCACATCGACGTGCGTTACGACTTCTCCGGGCATGACGCGCTGCTCGCG
CACGTCGGTCGGATCGACGCGCTCGAACGCGCGCGCCGCGACGACCTCGCGCGGCAGCGGCGCGCCGCGA
ACCGGCAGGACGACGACGCGGGCGGCGCGACGGCGATCGCGCGGGCGGCGGCGTCCGTCGCGAATGCGCC
GGGCGCCGCGCTGCCCCGCCGCATCGGCGTGTGTTGGGGGGACCCGGCGCACGACAGGCCCGATGGCGAC
GGCGCGCAACCGTGA
 Primer design