SecReT6
Protein ID: 126458224
SecReT6 ID186
T6SS typei3
Gene symbol-
Locus tagBURPS1106A_A0246
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]235548..236513 [+]
ProductImpE/SciE family protein
NoteTagJ
UniProt IDA3P1S9
KEGG IDbpl:BURPS1106A_A0246
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 2.80E-51, Aligned region: 149..294
Protein Sequence: 321 a.a.     [Download]
>gi|126458224|ref|YP_001074289.1| ImpE/SciE family protein [Burkholderia pseudomallei 1106a]
MTTPAFPAPPGARTSARPHDTPLDARLAAAQAAVRARPVDAASRWALFQLLCVTGQWERAVGQLQAYARF
AAQHAHIAHAYRDLIRAERFRARVMAGHARPGFVFDAPPWIDDLREALRAQAAGARDEADRARSRALDRA
PFVAGRGPDAPFDWIADSDSRFGPVCEVVTAGHDRWLPFADLAGWRLARPGVPLDLVWAPCVLTLADGSV
AHGFMPARYPGSELADGSGAPGASAAAHEADAHESAVREADALRLGSRTAWRDVGRTGVFALGRKTWSTS
AGDAGLFELHACEFGARARAGAVLGGAAREARGGEAADGCA
 
Nucleotide Sequence: 966 bp     [Download]
>gi|126455463|ref|NC_009078.1|:235548-236513 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGACGACGCCCGCCTTCCCGGCGCCGCCCGGCGCGCGCACGTCGGCCCGGCCGCACGATACGCCGCTCG
ACGCGCGGCTCGCGGCTGCGCAAGCCGCGGTGCGCGCCCGGCCCGTCGATGCGGCGAGCCGTTGGGCGCT
GTTTCAACTGCTCTGCGTGACGGGCCAGTGGGAACGCGCCGTCGGGCAGTTGCAGGCTTATGCGCGGTTC
GCCGCGCAGCACGCGCACATCGCGCACGCCTATCGCGACCTGATTCGCGCCGAGCGCTTTCGCGCCCGCG
TGATGGCGGGCCACGCGCGGCCGGGATTCGTATTCGATGCGCCGCCGTGGATCGACGATCTGCGGGAAGC
GTTGCGCGCGCAGGCGGCCGGCGCGCGCGACGAAGCCGACCGCGCGCGTTCGCGCGCGCTCGATCGCGCG
CCGTTCGTCGCGGGGCGCGGGCCGGATGCGCCGTTCGACTGGATCGCCGACAGCGATTCGCGATTCGGGC
CGGTCTGCGAAGTCGTGACCGCCGGGCATGATCGTTGGCTGCCGTTTGCGGATCTGGCCGGATGGCGGCT
CGCGCGCCCGGGCGTGCCGCTCGATCTGGTCTGGGCGCCGTGCGTGCTCACGCTTGCCGACGGCAGTGTC
GCGCACGGCTTCATGCCGGCGCGTTACCCGGGCTCCGAACTGGCCGACGGGAGCGGCGCGCCGGGCGCCT
CGGCGGCCGCGCACGAGGCCGATGCGCACGAGAGCGCCGTGCGCGAGGCCGATGCGTTGCGGCTCGGCAG
CCGGACCGCATGGCGCGACGTCGGCCGCACCGGCGTGTTCGCGCTCGGCCGCAAGACCTGGTCGACGAGC
GCGGGCGACGCCGGCCTTTTCGAGCTGCACGCGTGTGAATTCGGCGCGCGCGCCCGTGCGGGCGCCGTGC
TCGGCGGCGCGGCGCGCGAAGCGCGCGGCGGGGAGGCGGCCGATGGATGCGCATGA
 Primer design