SecReT6
Protein ID: 126463890
SecReT6 ID177
T6SS typei3
Gene symbol-
Locus tagRsph17029_3131
StrainRhodobacter sphaeroides ATCC 17029
Repliconchromosome II [GenBank: NC_009050] [Browse all T6SS(s) in this replicon]
Location [Strand]147812..151333 [+]
ProductImcF domain-containing protein
NoteTssM
UniProt IDA3PPG5
KEGG IDrsh:Rsph17029_3131
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.00E-86, Aligned region: 189..448
IcmF-related [PF06761], Evalue: 1.20E-66, Aligned region: 502..802
DUF1215 [PF06744], Evalue: 1.20E-31, Aligned region: 914..1032
AAA_16 [PF13191], Evalue: 0.00067, Aligned region: 127..259
Protein Sequence: 1173 a.a.     [Download]
>gi|126463890|ref|YP_001045003.1| ImcF domain-containing protein [Rhodobacter sphaeroides ATCC 17029]
MRALRSLLAALTSRTLWTFLGLALLCGLIWQFGALVSVGETVPLASDLARGLVVGCIVVGWLLSLLAAQL
RAARRNQLFVTELAAPAPAAPDPGAAAVAEVGARFRQVMAEMKRSRVGGRRFLRDMPWYLLIGPPGTGKT
TALRQSGLHFPIDPGDDLQGVGGTRNCDWFFTEGAVLVDTAGRYVQQQSDPEADAAEWSGFLDLLKRHRG
RRALNGVIVALSMTEILGPEPALRAHGREIRKRLSELGQRLQIRLPVYLMVTKADLVPGFETFFAPLPAR
GREQVWGATLAPDERPEGGAVDREARALWQELEARVGPRLAEEATLADRAEIFRFPARMAEVEAPLRVLI
ATLFGESRYEDSPWLRGFYFTSATQEGSPIDRMLGDLAGAFGLSPPAPPRRARSETRSYFLHDLLAKVIF
PEAGLGRLDRAAEERRRWLWRGSVAGAALATAVAGVGFLLSFLGWSGAIEDQARLTADLSARLANVAARQ
APTEPLDLPLALEAATAADAARTEPPSGPLAFIGPSAAAEIERAGTIAYERTLANVLALRMVALLEASMW
RQVRDPDDMLGALKAYFMLTGLAPYDRDFLTGWWQEELPQQAVLDPFPTEAARRHQLAALSLFGTQGDPV
PADEELVAAALASICTIPLAARAYGALMQDPAVTGLPDWIPGDEAGPNGARIFTRLSGKTLRVGLPGAFT
FAGFHETILPLVPEVAAQATLDRTLFAGGCGGSAGASAATLEADILKLYSDDFIARWDGLLRDIRLAPLT
DFATATAAMKDLASPDSALKRLLAAVVAETDLTRVPVPDAAPPEGLLKAASKKLGKVGKLVKGAAALSAG
SAPPTEPPGQAVARHFEPLKGMIAEVEGVPPRIGDAELALGALANALQTAAANPDPQAALTAQGGLATLT
GGLTEVAARLPPPIGAWLEGLATDTASVTREAAIARLNARYRADILPFCRAATAGRYPFEPGSAIDVNTA
DFQRLFGPGGLFDGFTGDALGPWIDTTRHPWAWRADLGLAARSLAPFEAARRMRDGLFAGGIGPVMGFLL
QATDLSPNAARVTLSLDGQQLVYMNAATPPVGMTWPGQNGTNLIVLSFTPLDGSAEAVTSESGAWAWLRL
IGKGSLSPTAQPDLFRLRLAAGAYGARFDLRANSVENPLDLRLFGGFRCPDGF
 
Nucleotide Sequence: 3522 bp     [Download]
>gi|126463752|ref|NC_009050.1|:147812-151333 Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence
ATGCGCGCGCTCCGCAGCCTCCTCGCCGCCCTGACCTCGCGGACGCTCTGGACCTTCCTCGGGCTCGCGC
TCCTCTGCGGGCTGATCTGGCAGTTCGGCGCGCTGGTCTCGGTGGGCGAGACGGTGCCGCTCGCCTCCGA
CCTCGCGCGGGGGCTGGTCGTGGGCTGCATCGTGGTGGGCTGGCTTCTGTCGCTGCTGGCAGCCCAGCTG
CGGGCGGCGCGCAGGAACCAGCTCTTCGTGACCGAGCTTGCGGCGCCCGCTCCCGCCGCCCCCGATCCCG
GCGCGGCGGCCGTGGCCGAGGTCGGGGCGCGGTTCCGGCAGGTGATGGCCGAGATGAAACGCTCGCGCGT
GGGCGGGCGGCGCTTTCTGCGCGACATGCCGTGGTATCTGCTGATCGGCCCGCCCGGCACCGGCAAGACC
ACGGCCCTGCGCCAGTCGGGGCTGCATTTCCCGATCGATCCCGGCGACGACCTGCAAGGCGTGGGCGGCA
CGCGGAACTGCGACTGGTTCTTCACCGAAGGGGCCGTGCTGGTGGACACGGCCGGGCGCTACGTCCAGCA
GCAGAGCGATCCCGAGGCCGATGCCGCGGAATGGTCGGGTTTTCTGGACCTTCTGAAGCGCCACCGCGGG
CGGCGGGCGCTGAATGGCGTGATCGTGGCCCTGTCGATGACCGAGATTCTCGGGCCCGAGCCCGCGCTGC
GCGCTCATGGCCGCGAGATCCGCAAGCGGCTGAGCGAGCTCGGCCAGAGGCTCCAGATCCGCCTGCCGGT
CTATCTGATGGTGACGAAGGCCGACCTCGTGCCGGGCTTCGAGACCTTCTTCGCGCCCCTGCCCGCGCGC
GGGCGCGAGCAGGTCTGGGGGGCGACGCTTGCACCCGACGAACGTCCCGAGGGCGGGGCGGTCGACCGCG
AGGCGCGGGCGCTCTGGCAGGAACTCGAGGCCCGCGTCGGGCCGCGGCTGGCCGAGGAGGCCACGCTGGC
CGACCGGGCCGAGATCTTCCGCTTCCCCGCGCGGATGGCCGAGGTCGAGGCGCCGCTGCGGGTGCTGATC
GCCACCCTCTTCGGCGAGAGCCGCTACGAGGACAGCCCCTGGCTCCGCGGTTTCTACTTCACCTCGGCCA
CGCAGGAGGGCTCGCCGATCGACCGGATGCTCGGGGATCTGGCGGGCGCCTTCGGCCTCAGCCCGCCCGC
GCCTCCCCGCCGGGCGCGGAGCGAGACACGCTCCTATTTCCTGCACGACCTGCTGGCGAAGGTGATCTTC
CCGGAAGCCGGGCTCGGTCGCCTCGACCGGGCGGCGGAGGAGCGGCGGCGCTGGCTCTGGCGCGGATCGG
TGGCGGGCGCGGCGCTTGCCACGGCGGTGGCGGGGGTGGGCTTCCTCCTCTCGTTCCTCGGCTGGTCGGG
CGCCATCGAGGATCAGGCGCGGCTGACCGCGGATCTCTCCGCCCGGCTGGCCAATGTGGCCGCGCGGCAG
GCACCGACCGAGCCGCTGGACCTGCCCCTCGCGCTGGAAGCCGCGACTGCCGCGGACGCCGCACGCACGG
AGCCGCCCTCGGGGCCCCTCGCCTTCATCGGCCCCTCGGCCGCGGCCGAGATCGAGCGGGCGGGCACCAT
CGCCTACGAGCGCACGCTGGCCAATGTGCTTGCGCTGCGGATGGTGGCGCTGCTCGAGGCCTCGATGTGG
CGGCAGGTGCGCGATCCCGACGACATGCTGGGCGCGCTCAAGGCCTATTTCATGCTGACAGGCCTCGCGC
CCTACGACCGCGACTTCCTGACCGGCTGGTGGCAGGAAGAGCTGCCGCAGCAGGCGGTGCTCGACCCGTT
CCCGACCGAGGCGGCCCGCAGGCACCAGCTGGCCGCGCTTTCCCTTTTCGGCACGCAGGGCGACCCTGTC
CCGGCCGACGAAGAGCTGGTGGCGGCGGCGCTGGCCAGCATCTGCACCATCCCCCTCGCGGCCCGCGCCT
ATGGCGCGCTGATGCAGGATCCCGCGGTCACGGGCCTGCCCGACTGGATCCCCGGAGACGAAGCTGGGCC
GAACGGCGCGAGGATCTTCACCCGCCTCTCTGGCAAGACGCTGCGGGTGGGGCTGCCCGGCGCCTTCACT
TTTGCGGGCTTTCACGAGACGATCCTGCCGCTCGTGCCGGAAGTCGCCGCGCAGGCCACGCTCGACCGGA
CCCTCTTTGCGGGCGGCTGCGGCGGCAGCGCCGGGGCCTCGGCCGCCACGCTCGAGGCGGACATCCTGAA
GCTCTATTCCGACGATTTCATCGCGCGCTGGGATGGGCTTCTGCGCGACATCCGGCTGGCGCCGCTGACG
GACTTCGCCACCGCCACTGCGGCGATGAAGGATCTGGCGAGCCCCGACAGCGCGCTGAAGCGGCTGCTCG
CTGCGGTCGTGGCCGAGACCGACCTCACGCGCGTCCCCGTCCCCGATGCGGCGCCGCCCGAGGGTCTCCT
CAAGGCCGCCAGCAAGAAGCTTGGGAAGGTGGGCAAGCTCGTGAAGGGGGCCGCGGCGCTGTCGGCGGGC
TCCGCTCCGCCCACGGAGCCGCCGGGGCAGGCGGTGGCGCGCCATTTCGAGCCGCTGAAGGGGATGATCG
CCGAGGTGGAGGGGGTGCCGCCGCGGATCGGGGATGCCGAACTCGCGCTCGGCGCGCTGGCCAATGCGCT
TCAGACCGCGGCGGCCAATCCCGATCCGCAGGCGGCGCTGACCGCGCAGGGGGGGCTTGCCACGCTGACG
GGCGGGCTGACCGAGGTCGCCGCCCGCCTGCCGCCCCCCATCGGCGCCTGGCTCGAGGGGCTGGCCACGG
ACACGGCCAGCGTGACGCGCGAGGCGGCGATCGCCCGGCTGAACGCGCGCTACCGGGCCGACATCCTGCC
CTTCTGCCGCGCCGCCACCGCGGGCCGCTATCCGTTCGAGCCGGGCTCGGCCATCGATGTGAACACAGCC
GATTTCCAGCGCCTCTTCGGACCCGGCGGCCTGTTCGACGGCTTCACGGGCGACGCGCTCGGGCCCTGGA
TCGACACGACGCGGCACCCCTGGGCGTGGCGCGCCGATCTGGGGCTCGCTGCCCGGAGCCTCGCGCCCTT
CGAGGCCGCCCGGCGGATGCGCGACGGTCTCTTCGCCGGAGGCATCGGCCCGGTGATGGGCTTCCTGCTT
CAGGCGACGGACCTGTCGCCCAATGCCGCCCGGGTGACGCTGAGCCTCGACGGCCAGCAGCTTGTCTACA
TGAATGCGGCGACGCCCCCCGTGGGCATGACCTGGCCCGGCCAGAACGGAACGAACCTCATCGTGCTCTC
CTTCACGCCGCTCGACGGGTCGGCCGAGGCGGTGACCTCGGAATCCGGCGCCTGGGCCTGGCTCCGGCTG
ATCGGCAAGGGCAGCCTCTCGCCCACCGCGCAGCCCGACCTGTTCCGGCTGCGCCTCGCCGCCGGAGCCT
ATGGCGCGCGCTTCGATCTCCGGGCGAATTCGGTGGAGAACCCGCTCGACCTCAGGCTCTTCGGCGGGTT
CCGCTGCCCGGATGGCTTCTGA
 Primer design