SecReT6
Protein ID: 126463893
SecReT6 ID177
T6SS typei3
Gene symbol-
Locus tagRsph17029_3134
StrainRhodobacter sphaeroides ATCC 17029
Repliconchromosome II [GenBank: NC_009050] [Browse all T6SS(s) in this replicon]
Location [Strand]154144..156552 [-]
Producthypothetical protein
NoteTssM
UniProt IDA3PPG8
KEGG IDrsh:Rsph17029_3134
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.40E-41, Aligned region: 198..483
DUF1215 [PF06744], Evalue: 1.70E-25, Aligned region: 554..671
Protein Sequence: 802 a.a.     [Download]
>gi|126463893|ref|YP_001045006.1| hypothetical protein Rsph17029_3134 [Rhodobacter sphaeroides ATCC 17029]
MPQDLARGPASDPFARAAAPALAFAEELGRRRDPPSALAAEARAHLDRFGRVLADRVPAAAVPPARYALA
LVIDRQARANPSLDLRLWEAAARGQLFDGRVLGEPDLRRFLRSAAEAGPAFAPVQPFLQACLDRLEARRT
RLQPPAVESWRGIAAVLAASFGFAVAGWALHVEWSFHHRLAEAFEARAAEAAALPLRARLDTLADAASGV
ATEVQRAPVALAAGPLGFDAAASAEAAYRAELQAALPAVLVQAVEEAIASEAGPAASYDTVRAWAILSGA
ADWSPAWLAGWLDRPAAPAEMRGLARHVRQLSPPEGTLPQPDADLLAQARGFAAEASEADRAWLELLRSE
GAAALPPWQAEAAVPGLASVVIRRSGAALDAPVPGLFTAAGWTYARDRGAGLAVQAARREARLLDRPTSE
TNASADRVLELLQAETLARWQALLADLRVVPFQTADTAVRVSGALARPESPLTQLLREVWHQVGGEDPLR
PHALQLKIAAVFGPTRQFVDQGGMARIAALFAALNAALGGLDRDSPTGLQRLMQAEDRARSIATLRQAPA
LVVEIIEDLLAQAGSAQAAGLTNPLTAAWQAEVLPLCRATLDGRYPFVEGADADPAAVERLLGRNGALAA
FVAARAAPYLDRSASPWRWKPEARFAGLSPDSAAFLERASAAGPGMTGPMALTLTALAERGTAAVTLGGQ
GGPVTTTSDSLRLDWPGLQPDRGAEIALRTPEGAARLAAPGPWGLLRLLEPFRLRPREGGLRFLIDLRSG
GARLFLEAAFDAAPNPLSVRRLVRGLACPQVL
 
Nucleotide Sequence: 2409 bp     [Download]
>gi|126463752|ref|NC_009050.1|:c156552-154144 Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence
ATGCCGCAGGATCTCGCCCGAGGCCCCGCCTCCGATCCGTTCGCCCGCGCCGCGGCCCCCGCGCTGGCCT
TCGCCGAGGAGCTGGGCCGGAGGCGTGATCCTCCCTCCGCGCTGGCGGCCGAGGCCCGGGCGCATCTCGA
CCGGTTCGGGCGCGTGCTCGCGGACCGGGTTCCTGCGGCCGCGGTGCCGCCCGCGCGCTATGCGCTGGCG
CTGGTGATCGACCGGCAGGCACGCGCGAACCCGAGCCTCGACCTGCGTCTGTGGGAAGCGGCCGCCCGCG
GGCAGCTCTTCGACGGCCGCGTGCTGGGCGAGCCGGACCTGCGCCGCTTCCTCCGCAGCGCGGCCGAGGC
CGGGCCCGCCTTCGCGCCGGTGCAGCCGTTCCTGCAGGCCTGCCTTGACCGACTCGAGGCCCGGCGGACG
CGCCTCCAGCCGCCCGCGGTGGAAAGCTGGCGCGGGATCGCGGCGGTTCTGGCCGCCTCCTTCGGGTTCG
CGGTGGCGGGCTGGGCGCTGCATGTCGAATGGAGCTTCCATCACAGGCTGGCCGAGGCCTTCGAGGCCCG
TGCTGCGGAGGCGGCGGCCCTGCCGCTCCGCGCGCGGCTCGACACGCTCGCGGATGCGGCGTCCGGTGTC
GCGACCGAGGTGCAGCGGGCGCCGGTCGCGCTGGCCGCGGGGCCTCTCGGCTTCGATGCGGCGGCAAGTG
CCGAGGCAGCCTACCGCGCGGAGCTGCAGGCCGCGCTGCCGGCAGTTCTGGTGCAGGCCGTCGAGGAAGC
CATCGCCTCCGAGGCGGGACCTGCCGCGAGCTACGACACGGTCCGGGCCTGGGCGATCCTGAGCGGGGCG
GCCGACTGGTCGCCCGCCTGGCTTGCCGGCTGGCTCGACCGTCCGGCGGCCCCGGCGGAGATGCGGGGCC
TGGCGCGGCATGTGCGGCAGCTGTCGCCGCCCGAGGGCACCCTGCCGCAGCCCGATGCCGACCTTCTGGC
GCAGGCCCGCGGCTTTGCCGCCGAAGCGTCCGAGGCCGACCGTGCCTGGCTCGAACTCCTGCGCTCGGAA
GGGGCGGCGGCCCTTCCGCCGTGGCAAGCGGAGGCGGCGGTGCCGGGGCTGGCTTCCGTGGTGATCCGCC
GGTCGGGGGCCGCGCTCGACGCGCCGGTCCCCGGCCTCTTCACGGCGGCGGGCTGGACCTACGCCCGCGA
CCGCGGCGCCGGGCTGGCGGTGCAGGCGGCGCGGCGCGAGGCGCGGCTGCTCGACCGGCCGACGTCCGAG
ACCAACGCCAGCGCCGACCGCGTGCTGGAGCTTCTGCAGGCCGAGACGCTCGCCCGGTGGCAGGCCCTGC
TCGCCGATCTGCGCGTGGTGCCCTTCCAGACCGCCGACACGGCCGTGCGGGTCTCGGGCGCGCTGGCGCG
ACCCGAGTCGCCCCTCACGCAGCTTCTGCGCGAGGTCTGGCATCAGGTGGGCGGCGAGGATCCGCTGCGG
CCCCATGCGCTGCAGCTGAAGATCGCGGCCGTCTTCGGGCCGACACGGCAGTTCGTGGATCAAGGTGGCA
TGGCACGGATCGCCGCGCTCTTTGCGGCGCTGAATGCGGCTTTGGGGGGCCTCGACCGCGACAGTCCGAC
GGGTCTCCAGCGGCTGATGCAGGCCGAGGACCGGGCGCGCAGCATCGCCACGCTGCGGCAGGCGCCCGCG
CTGGTGGTCGAGATCATCGAGGATCTGCTGGCGCAGGCGGGGTCGGCGCAGGCCGCGGGCCTCACGAACC
CGCTGACAGCGGCGTGGCAGGCCGAAGTGCTGCCGCTCTGTCGCGCGACGCTCGACGGGCGCTATCCGTT
CGTCGAGGGGGCCGACGCCGACCCTGCGGCGGTGGAGCGGCTTCTGGGCCGGAACGGGGCGCTCGCGGCC
TTCGTGGCGGCGCGCGCCGCGCCCTATCTCGACCGCAGCGCCAGCCCCTGGCGCTGGAAGCCCGAGGCAC
GCTTCGCCGGGCTTTCGCCCGACAGCGCGGCCTTCCTCGAACGGGCGAGCGCCGCAGGTCCGGGCATGAC
CGGGCCGATGGCGCTCACGCTCACCGCTCTGGCCGAGCGGGGCACGGCCGCGGTGACGCTCGGCGGGCAG
GGCGGCCCCGTCACCACCACGAGCGACAGCCTGCGGCTCGACTGGCCCGGCCTGCAGCCCGACCGCGGCG
CCGAGATCGCCCTGCGCACGCCGGAAGGCGCGGCGCGGCTGGCGGCGCCGGGGCCCTGGGGCCTCCTCCG
GCTCCTCGAGCCCTTCCGGCTGCGCCCCCGCGAGGGCGGGCTGCGGTTCCTCATCGACCTGCGCTCCGGC
GGCGCGCGGCTCTTTCTCGAAGCCGCCTTCGACGCGGCGCCGAACCCGCTCTCGGTGCGCAGACTCGTGC
GCGGGCTCGCCTGTCCGCAGGTCCTGTGA
 Primer design