SecReT6
Protein ID: 126641334
SecReT6 ID195
T6SS typei4b
Gene symbol-
Locus tagA1S_1288
StrainAcinetobacter baumannii ATCC 17978
Repliconchromosome [GenBank: NC_009085] [Browse all T6SS(s) in this replicon]
Location [Strand]1511966..1513246 [+]
Productputative VGR-related protein
NoteTssI
UniProt IDA3M472
KEGG IDacb:A1S_1288
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.90E-30, Aligned region: 1..215
Protein Sequence: 426 a.a.     [Download]
>gi|126641334|ref|YP_001084318.1| putative VGR-related protein [Acinetobacter baumannii ATCC 17978]
MQSNESDYDFLTRLWRSEGINWLVDESQLFVADPNASIQPQVLRLIDDNQNYQALERRSIRYQRSSATEQ
FDTITQVKAERRLQPTSVHVQRWQADALQQEEGSGSVQGTQKHSEHYDNASLNLEDAWHVSPAWMQDLNG
KDQATASGNSQIEQLNQHINAYHHLSSKQFTVAGNVRDAQVGYWFELNDHPELDQHDSADKEFLILSKHY
YNQNNLPKELQQQLERLLPQGKLKAAQLDSQNPEQRHFAELNVVRRNIKAVPEYNPLEHRPAAHPQRARV
VGLEGESIHVDQWGRIKVRFLLPELMTTAMMVELEVTTMTPTRLGSMYSLLGQGQVMAHVSCHVLVKLLS
SISLTVMLTARLWWGVFMKPSANQRSSTRKASYLTPRNLAVSVQKKSMAKALTSSVLMTPQAKSVPSYKV
AMPQAS
 
Nucleotide Sequence: 1281 bp     [Download]
>gi|126640115|ref|NC_009085.1|:1511966-1513246 Acinetobacter baumannii ATCC 17978, complete genome
ATGCAGTCAAATGAAAGCGATTATGACTTTTTAACCCGTTTGTGGCGTAGTGAAGGTATTAACTGGCTGG
TCGATGAGTCACAGCTTTTTGTCGCTGACCCAAATGCTTCTATCCAGCCACAAGTACTGCGTTTAATTGA
CGATAACCAAAATTATCAGGCACTTGAACGCCGTAGCATCCGCTATCAACGCAGCAGTGCGACAGAGCAG
TTCGATACGATTACCCAAGTCAAAGCTGAGCGTCGTTTACAACCAACCTCGGTTCATGTGCAACGCTGGC
AAGCCGATGCTTTGCAACAAGAAGAAGGTAGCGGCAGCGTACAAGGCACCCAAAAGCACAGCGAACACTA
TGACAATGCCAGCCTGAACCTTGAAGATGCATGGCATGTTAGCCCAGCGTGGATGCAGGATTTAAACGGG
AAAGATCAAGCCACAGCTTCGGGAAATAGCCAGATTGAACAACTTAACCAGCACATCAATGCTTACCATC
ACCTGAGTTCTAAACAGTTTACCGTTGCAGGTAACGTCCGTGATGCACAAGTGGGTTACTGGTTTGAGCT
GAATGACCATCCGGAACTTGACCAACATGATAGTGCTGATAAAGAGTTCTTAATCTTAAGCAAACACTAC
TATAACCAGAATAATTTACCGAAAGAATTACAACAACAACTTGAGCGCCTATTACCACAAGGCAAACTCA
AGGCAGCCCAACTCGACAGCCAAAACCCTGAGCAGCGCCACTTTGCTGAGCTGAATGTCGTTCGTCGTAA
TATTAAAGCTGTGCCTGAATATAACCCGTTAGAGCACCGACCAGCCGCTCACCCACAGCGCGCTAGAGTG
GTGGGTTTAGAGGGTGAAAGCATTCATGTCGACCAGTGGGGACGCATTAAAGTCCGTTTCCTTTTACCCG
AGCTGATGACCACAGCCATGATGGTGGAGCTGGAAGTAACGACAATGACACCGACTCGGCTTGGGTCGAT
GTACTCACTCCTTGGGCAGGGGCAGGTTATGGCGCACGTTTCTTGCCACGTGTTGGTGAAATTGTTGTCA
TCGATTTCTTTGACGGTAATGTTGACCGCCCGTTTGTGGTGGGGCGTATTCATGAAGCCGAGCGCCAACC
AACGCAGTTCGACCAGAAAGGCCAGCTACCTGACACCAAGAAACTTAGCGGTATCCGTTCAGAAGAAGTC
GATGGCAAAGGCTTTAACCAGCTCCGTTTTGATGACACCACAGGCCAAATCAGTGCCCAGTTACAAAGTA
GCCATGCCGCAAGCCAGCTAA
 Primer design