SecReT6
Protein ID: 126641335
SecReT6 ID195
T6SS typei4b
Gene symbol-
Locus tagA1S_1289
StrainAcinetobacter baumannii ATCC 17978
Repliconchromosome [GenBank: NC_009085] [Browse all T6SS(s) in this replicon]
Location [Strand]1513051..1514238 [+]
Productputative VGR-related protein
NoteTssI
UniProt IDA3M473
KEGG IDacb:A1S_1289
PDB IDNA
Domain hit(s) vs Pfam DUF2345 [PF10106], Evalue: 1.90E-46, Aligned region: 163..314
T6SS_Vgr [PF13296], Evalue: 4.90E-40, Aligned region: 32..140
T6SS_Vgr [PF13296], Evalue: 4.90E-40, Aligned region: 180..223
T6SS_Vgr [PF13296], Evalue: 4.90E-40, Aligned region: 244..267
T6SS_Vgr [PF13296], Evalue: 4.90E-40, Aligned region: 286..312
Sarcoglycan_1 [PF04790], Evalue: 3.60E-05, Aligned region: 173..227
Sarcoglycan_1 [PF04790], Evalue: 3.60E-05, Aligned region: 243..294
DUF3540 [PF12059], Evalue: 0.00091, Aligned region: 159..222
DUF3540 [PF12059], Evalue: 0.00091, Aligned region: 237..287
Protein Sequence: 395 a.a.     [Download]
>gi|126641335|ref|YP_001084319.1| putative VGR-related protein [Acinetobacter baumannii ATCC 17978]
MVGRIHEAERQPTQFDQKGQLPDTKKLSGIRSEEVDGKGFNQLRFDDTTGQISAQLQSSHAASQLNLGNL
SHPKDKAESDGRGEGFELRTDQWGAVRAGSGLLISTHKQDQAQGVHLDASEAKQQIEGGLNNAKALSEVA
KNQQTDPLDMLENIQTFLEVLKQEDPKKAAEFQSAVMLLASPKSIAVSSNEDIHLSANGQLTQSAGDSIN
MSTQKNIVNHASQKISLFAAQEGARLFAGKGKVEIQAQGDGLDVIARKGIQITSTEDTVFITSPTEINLT
ANGSQVKLNGSGIFPVTGGKLEVKAGQHLFMGGEQVTPPKKQENKPCYLTFEITDLDGKPAKNVEYIAFR
MDGSRQKGQTNAQGLTQRFETDGSEQISIHICDENASKYKLAAKG
 
Nucleotide Sequence: 1188 bp     [Download]
>gi|126640115|ref|NC_009085.1|:1513051-1514238 Acinetobacter baumannii ATCC 17978, complete genome
GTGGTGGGGCGTATTCATGAAGCCGAGCGCCAACCAACGCAGTTCGACCAGAAAGGCCAGCTACCTGACA
CCAAGAAACTTAGCGGTATCCGTTCAGAAGAAGTCGATGGCAAAGGCTTTAACCAGCTCCGTTTTGATGA
CACCACAGGCCAAATCAGTGCCCAGTTACAAAGTAGCCATGCCGCAAGCCAGCTAAACTTGGGTAACTTA
AGCCATCCAAAAGACAAGGCGGAAAGCGATGGTCGTGGGGAAGGTTTTGAACTCAGAACTGACCAGTGGG
GCGCGGTTCGAGCAGGCAGTGGCTTACTCATTAGTACCCACAAACAGGATCAGGCTCAAGGTGTACATCT
TGATGCAAGCGAGGCTAAGCAACAAATCGAAGGCGGCCTCAATAATGCCAAGGCACTCAGTGAAGTTGCT
AAAAATCAGCAAACTGACCCGTTAGATATGCTTGAGAATATTCAGACTTTTTTAGAAGTTCTCAAACAAG
AAGATCCTAAAAAAGCTGCTGAATTTCAATCAGCAGTGATGCTGCTGGCATCACCAAAAAGTATTGCTGT
AAGTAGTAATGAAGATATACACCTCAGTGCAAATGGTCAGCTCACTCAAAGTGCTGGAGATAGCATTAAT
ATGAGTACGCAAAAGAATATAGTGAATCATGCGAGCCAAAAGATTAGTCTCTTTGCCGCTCAGGAGGGTG
CTCGACTTTTTGCTGGGAAGGGCAAAGTAGAAATTCAAGCTCAAGGTGATGGCTTAGATGTCATTGCTCG
AAAAGGTATACAGATTACTTCAACCGAAGACACAGTTTTTATTACTAGCCCAACTGAGATTAATCTGACA
GCAAACGGATCTCAAGTTAAGCTGAACGGTTCAGGTATTTTCCCTGTCACGGGTGGTAAGCTTGAGGTGA
AGGCTGGGCAGCACTTGTTTATGGGGGGAGAACAAGTTACTCCTCCTAAAAAGCAGGAAAATAAACCTTG
TTATTTGACTTTTGAAATTACTGATTTAGATGGAAAGCCAGCGAAAAATGTAGAGTATATTGCTTTTAGA
ATGGATGGTAGCCGGCAAAAGGGACAAACTAATGCCCAAGGTTTAACTCAAAGATTTGAAACTGATGGCT
CAGAACAAATTTCCATTCATATTTGTGATGAAAATGCTTCTAAATATAAACTAGCGGCAAAAGGTTAA
 Primer design