SecReT6
Protein ID: 126641339
SecReT6 ID195
T6SS typei4b
Gene symbol-
Locus tagA1S_1293
StrainAcinetobacter baumannii ATCC 17978
Repliconchromosome [GenBank: NC_009085] [Browse all T6SS(s) in this replicon]
Location [Strand]1519781..1519930 [+]
Producthypothetical protein
NoteTssB
UniProt IDA3M477
KEGG IDacb:A1S_1293
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.50E-12, Aligned region: 4..45
Protein Sequence: 49 a.a.     [Download]
>gi|126641339|ref|YP_001084323.1| hypothetical protein A1S_1293 [Acinetobacter baumannii ATCC 17978]
MFRLTYDVEIGDAKEAKELPFVVGVMGDFSAASELERTKLKDKNSLMSI
 
Nucleotide Sequence: 150 bp     [Download]
>gi|126640115|ref|NC_009085.1|:1519781-1519930 Acinetobacter baumannii ATCC 17978, complete genome
GTGTTCAGACTTACATATGATGTCGAAATTGGTGATGCGAAAGAAGCGAAAGAACTACCATTCGTTGTAG
GTGTAATGGGTGATTTTTCAGCTGCATCTGAGCTTGAGCGTACAAAATTAAAAGATAAAAATTCATTAAT
GTCGATTTAG
 Primer design

Protein ID: 126641340
SecReT6 ID195
T6SS typei4b
Gene symbol-
Locus tagA1S_1294
StrainAcinetobacter baumannii ATCC 17978
Repliconchromosome [GenBank: NC_009085] [Browse all T6SS(s) in this replicon]
Location [Strand]1519993..1520232 [+]
Producthypothetical protein
NoteTssB
UniProt IDA3M478
KEGG IDacb:A1S_1294
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.20E-24, Aligned region: 3..78
Protein Sequence: 79 a.a.     [Download]
>gi|126641340|ref|YP_001084324.1| hypothetical protein A1S_1294 [Acinetobacter baumannii ATCC 17978]
MTEEGGKMAVDLTFKSMEDFRPENVVQQVDPLKKLVEARERLTDLRNKISNSERLEDLLDEVLKNTDQIR
KLSAEADHE
 
Nucleotide Sequence: 240 bp     [Download]
>gi|126640115|ref|NC_009085.1|:1519993-1520232 Acinetobacter baumannii ATCC 17978, complete genome
TTGACAGAAGAAGGCGGTAAAATGGCTGTTGATTTAACATTTAAATCAATGGAAGATTTTCGCCCGGAAA
ATGTTGTACAGCAAGTTGATCCATTAAAGAAATTGGTTGAGGCGCGTGAGCGTTTAACCGATTTAAGAAA
CAAAATTTCAAACAGTGAGCGTTTAGAAGATCTGCTTGATGAGGTTCTTAAAAATACTGATCAAATCCGT
AAATTAAGTGCGGAGGCCGATCATGAATAA
 Primer design