SecReT6
Protein ID: 126641341
SecReT6 ID195
T6SS typei4b
Gene symbol-
Locus tagA1S_1295
StrainAcinetobacter baumannii ATCC 17978
Repliconchromosome [GenBank: NC_009085] [Browse all T6SS(s) in this replicon]
Location [Strand]1520375..1521706 [+]
Producthypothetical protein
NoteTssC
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.40E-191, Aligned region: 15..439
Protein Sequence: 443 a.a.     [Download]
>gi|126641341|ref|YP_001084325.1| hypothetical protein A1S_1295 [Acinetobacter baumannii ATCC 17978]
MAGTITVSENMTLSIDKRIAEIDALISKQLSQIMHNEQFQKIESTWRGLYYFCQETPSNPLIKIRMLNTT
KKELVKDFQGATDFDQSTLFKKIYEEEYGSFGGAPYSALIGDFEFDRTPSDMYLLEQISHVSAAAHAPFI
SAASPSILGLESFTDIDRPRDVSKIFETAEYVQWRSFRDSEDSRYVALTLPHVLGRLPYHPKEGTATEGF
NFIEDVSGENHNEYLWMNAAYAFGTRLTNAFDMHGWCAAIRGVEGGGLVEGLPVHTFKTQDGEVVFKCPT
EIAITDRREKELSDLGFIPLVHCKNTDYAAFFGAQSTQKPKKYDNDTANANSALSSQIQYIMAVSRIAHY
LKAMMRDKVGSFASAGNVEAFLNEWLSQYVLLDDGASQEAKAQYPLREASVKVVEDPAQPGHYKSVVFLR
PHFQLDELSVSLRLVTELPQSSN
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|126640115|ref|NC_009085.1|:1520375-1521706 Acinetobacter baumannii ATCC 17978, complete genome
ATGGCAGGAACCATTACTGTTTCTGAAAATATGACTTTATCAATTGATAAGCGTATTGCAGAAATTGATG
CTCTGATTTCAAAGCAGTTAAGTCAGATCATGCACAATGAACAATTCCAAAAAATTGAGTCAACTTGGCG
TGGTCTTTATTACTTTTGTCAGGAAACGCCTTCAAATCCGCTCATTAAAATTCGTATGCTTAATACGACT
AAGAAAGAGTTGGTAAAAGATTTCCAAGGTGCTACAGACTTTGATCAAAGCACTTTGTTTAAGAAAATCT
ACGAAGAAGAATACGGTTCTTTTGGTGGTGCACCATACTCAGCATTAATTGGTGATTTTGAGTTTGATCG
TACTCCATCTGATATGTATTTGCTTGAGCAAATCTCTCATGTTTCAGCGGCAGCACATGCACCATTTATT
TCAGCTGCTAGTCCGAGCATTTTAGGCCTTGAATCATTTACAGATATTGATCGTCCTAGAGATGTTTCAA
AAATCTTTGAAACCGCTGAATATGTTCAATGGCGTTCGTTCCGTGATAGTGAAGACTCACGTTATGTTGC
ATTGACTTTACCTCATGTCTTGGGTCGTCTCCCATATCATCCAAAAGAAGGTACTGCGACAGAAGGCTTT
AATTTTATTGAAGATGTTTCTGGTGAAAACCACAATGAATATTTGTGGATGAATGCAGCTTATGCTTTTG
GTACTCGCTTAACAAATGCATTTGATATGCATGGTTGGTGTGCTGCTATTCGCGGTGTTGAAGGTGGTGG
TTTAGTTGAAGGCTTGCCAGTACATACTTTTAAAACACAAGATGGCGAAGTGGTATTCAAGTGTCCAACT
GAAATTGCAATCACGGATCGCCGTGAAAAAGAGTTAAGCGATCTAGGTTTCATTCCGTTAGTACATTGTA
AAAATACAGATTACGCAGCTTTCTTTGGCGCGCAATCAACTCAAAAACCTAAAAAATATGACAATGATAC
AGCCAATGCAAACTCGGCTTTATCAAGTCAGATTCAGTACATCATGGCTGTTTCACGTATTGCTCATTAC
TTAAAAGCAATGATGCGAGATAAAGTGGGTAGCTTTGCTTCTGCTGGAAATGTTGAAGCATTCTTAAATG
AGTGGTTGTCACAGTATGTCTTACTTGACGATGGTGCTTCTCAAGAAGCGAAAGCTCAATACCCGTTACG
TGAAGCGTCTGTAAAAGTTGTAGAAGATCCTGCTCAACCAGGTCACTACAAATCTGTGGTTTTCTTGCGA
CCACATTTCCAGCTGGATGAGTTGTCGGTTTCTTTACGACTTGTCACTGAGTTACCTCAGTCCTCAAATT
AA
 Primer design