SecReT6
Protein ID: 126641343
SecReT6 ID195
T6SS typei4b
Gene symbol-
Locus tagA1S_1297
StrainAcinetobacter baumannii ATCC 17978
Repliconchromosome [GenBank: NC_009085] [Browse all T6SS(s) in this replicon]
Location [Strand]1522474..1522815 [+]
Producthypothetical protein
NoteTssE
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 8.10E-13, Aligned region: 10..90
Protein Sequence: 113 a.a.     [Download]
>gi|126641343|ref|YP_001084327.1| hypothetical protein A1S_1297 [Acinetobacter baumannii ATCC 17978]
MLNSRVAKLDHVIDDYPLVKKSILQFGIIDFVGLSTANPLDRDKICQSIEQSIAAHEPRLRQIRVEMLLD
GHNMGALCLSIQAYLNIHPLYEPVVFDALLKPTTQQYVISART
 
Nucleotide Sequence: 342 bp     [Download]
>gi|126640115|ref|NC_009085.1|:1522474-1522815 Acinetobacter baumannii ATCC 17978, complete genome
TTGCTCAATAGTCGGGTAGCAAAGTTAGATCATGTGATTGATGACTATCCACTTGTAAAAAAATCGATAC
TTCAGTTCGGGATTATTGATTTTGTGGGGCTTTCTACAGCCAACCCTCTGGATCGGGATAAAATTTGCCA
ATCCATTGAGCAATCAATAGCAGCTCATGAACCTCGGCTAAGACAAATACGGGTAGAGATGTTATTAGAT
GGACATAATATGGGCGCATTATGTTTAAGTATTCAGGCTTATCTAAATATTCACCCCTTATATGAACCTG
TTGTATTTGATGCATTGTTAAAACCAACAACGCAGCAATATGTAATTTCAGCAAGAACTTAA
 Primer design