SecReT6
Protein ID: 126641344
SecReT6 ID195
T6SS typei4b
Gene symbol-
Locus tagA1S_1298
StrainAcinetobacter baumannii ATCC 17978
Repliconchromosome [GenBank: NC_009085] [Browse all T6SS(s) in this replicon]
Location [Strand]1523066..1523623 [+]
Producthypothetical protein
NoteTssF
UniProt IDA3M482
KEGG IDacb:A1S_1298
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.10E-42, Aligned region: 2..178
Protein Sequence: 185 a.a.     [Download]
>gi|126641344|ref|YP_001084328.1| hypothetical protein A1S_1298 [Acinetobacter baumannii ATCC 17978]
MFPQYLRHFPACSVVSFEDINKIKQLKEPHLVPHHTVLKSRSFKGVQCEFNTTQDVKLLPIHLSGLDFKT
TPSAHMHLNQNATLSLKFEIFNNAHACLTDEKLPIYLDAISNFPLQVLDSIFKKGTSFAVKYGQTIVELS
KNPFELIGFAEQESLLPLDQHTHHAYRLLMEYFCFPESLVILSSI
 
Nucleotide Sequence: 558 bp     [Download]
>gi|126640115|ref|NC_009085.1|:1523066-1523623 Acinetobacter baumannii ATCC 17978, complete genome
ATGTTCCCTCAATACTTACGACATTTTCCTGCGTGTTCAGTTGTTAGCTTTGAAGATATTAATAAGATTA
AACAGCTTAAAGAACCTCATCTTGTACCTCATCATACGGTTTTGAAATCTCGTAGTTTCAAAGGAGTACA
GTGTGAGTTTAATACAACTCAAGATGTTAAATTACTGCCTATTCATTTAAGTGGTTTAGATTTTAAAACT
ACACCTAGTGCACATATGCACTTAAATCAAAATGCGACGTTGAGCCTTAAATTTGAAATTTTTAATAATG
CTCATGCTTGTTTAACTGATGAGAAGCTTCCTATTTATTTGGATGCTATCTCTAATTTTCCTCTACAGGT
CCTTGATAGTATTTTCAAAAAAGGAACCAGTTTTGCGGTTAAATATGGACAAACAATTGTAGAATTGAGC
AAGAATCCATTCGAATTGATTGGTTTTGCAGAACAAGAAAGTTTATTACCGCTTGATCAACATACCCATC
ATGCTTATCGTTTGTTGATGGAATACTTTTGTTTCCCGGAAAGTTTAGTTATCTTAAGCTCGATTTAG
 Primer design