SecReT6
Protein ID: 126641345
SecReT6 ID195
T6SS typei4b
Gene symbol-
Locus tagA1S_1299
StrainAcinetobacter baumannii ATCC 17978
Repliconchromosome [GenBank: NC_009085] [Browse all T6SS(s) in this replicon]
Location [Strand]1523946..1524641 [+]
Producthypothetical protein
NoteTssF
UniProt IDA3M483
KEGG IDacb:A1S_1299
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.00E-49, Aligned region: 6..231
Protein Sequence: 231 a.a.     [Download]
>gi|126641345|ref|YP_001084329.1| hypothetical protein A1S_1299 [Acinetobacter baumannii ATCC 17978]
MSHYHNDTARFFYSVNYQKLQSNFVEMGYSIISKNLNPFSTRSDFISTKLLCSNRDLPHEALGQSNNVLN
LNDSSLARRAIVLKRPTKPYKFEQGQSEQWRVISHLSLNSLALMKGDAVSHVKELLALYNLPQSKENYLI
IESIKKLEFSLTHKLVDGKPFPMFVRGVKAELQIDSSVFRGHSLYIFSQLLSRVFNLKVQINSFVDLVVK
DYSSQQELYQCTQNVGGKTLL
 
Nucleotide Sequence: 696 bp     [Download]
>gi|126640115|ref|NC_009085.1|:1523946-1524641 Acinetobacter baumannii ATCC 17978, complete genome
ATGAGCCATTACCACAATGATACAGCTCGCTTTTTTTACTCAGTGAACTATCAAAAGTTACAGTCCAATT
TCGTTGAAATGGGTTATTCTATTATTTCTAAAAATTTAAATCCATTTTCAACGCGCTCAGATTTTATTAG
CACCAAATTATTATGTTCAAACCGTGATTTACCTCATGAAGCACTGGGTCAGTCTAATAACGTATTAAAT
TTAAATGATAGTAGCTTGGCGAGACGTGCCATTGTTTTAAAACGACCTACCAAGCCTTATAAGTTTGAAC
AAGGCCAAAGTGAACAGTGGCGTGTGATCTCGCATCTTTCATTAAATAGCTTGGCGCTTATGAAAGGGGA
TGCTGTTTCTCATGTTAAAGAGCTGCTGGCTTTATATAACTTACCGCAGTCAAAAGAAAACTATTTAATT
ATAGAATCAATTAAAAAATTAGAATTTTCTCTTACCCATAAACTCGTAGATGGCAAACCATTTCCAATGT
TTGTAAGAGGAGTGAAAGCTGAATTACAAATTGATTCATCCGTATTTAGAGGGCATAGCTTATATATTTT
TAGTCAGTTATTAAGTCGTGTTTTTAATTTAAAGGTTCAAATTAATAGTTTTGTTGATTTGGTGGTTAAG
GATTATTCATCTCAGCAGGAGTTATACCAATGCACTCAGAACGTTGGTGGCAAGACTCTTCTGTAA
 Primer design