SecReT6
Protein ID: 126641346
SecReT6 ID195
T6SS typei4b
Gene symbol-
Locus tagA1S_1300
StrainAcinetobacter baumannii ATCC 17978
Repliconchromosome [GenBank: NC_009085] [Browse all T6SS(s) in this replicon]
Location [Strand]1524707..1525603 [+]
Producthypothetical protein
NoteTssG
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.10E-59, Aligned region: 10..278
Protein Sequence: 298 a.a.     [Download]
>gi|126641346|ref|YP_001084330.1| hypothetical protein A1S_1300 [Acinetobacter baumannii ATCC 17978]
MPANDAALSWSDHFKFETSFNLNFPATEIESLELVDERVHLTNLIVGLTGIQGALPYTYTNKIKQAPRQQ
RAETKEFLSLFNHKLTSQYVESSITYHLPVRYEIENKNDYLDILHALNGYVRSQHQQQDLDEYFAEFSGL
MQGQNNTVHALKTMLSCIFKHEITIKEFVQESFKLAGDQLTTLGGSQPSLLGINTFCGETIQQIDGKIEI
QIGPLKRQQYLKFLPHQELSLKLKKIVETWCSPTLSIDLRLILDESEIQPVRLTQGQESGLGQGAFLMSR
KPNTHNDETCYSLIGEQI
 
Nucleotide Sequence: 897 bp     [Download]
>gi|126640115|ref|NC_009085.1|:1524707-1525603 Acinetobacter baumannii ATCC 17978, complete genome
ATGCCTGCCAATGACGCAGCTTTGTCATGGTCTGACCATTTTAAATTTGAGACCTCATTTAACTTAAATT
TTCCGGCTACTGAAATTGAAAGTTTAGAGTTAGTAGATGAGCGTGTTCATTTAACAAACCTGATCGTTGG
TCTTACCGGTATACAAGGTGCATTACCTTATACATATACAAATAAAATTAAGCAGGCTCCAAGGCAACAA
CGCGCTGAAACGAAAGAGTTTTTAAGCTTATTTAATCATAAGTTGACCAGTCAGTATGTAGAGTCAAGTA
TTACTTATCACTTGCCTGTGCGCTATGAAATTGAAAATAAAAATGATTATTTGGATATTCTTCATGCATT
GAATGGCTATGTTCGCTCACAACATCAGCAACAAGACTTGGATGAATATTTCGCTGAATTTTCAGGCCTA
ATGCAAGGGCAAAATAATACGGTTCATGCTTTAAAGACGATGTTGAGTTGTATTTTTAAGCATGAAATTA
CAATTAAAGAGTTTGTACAGGAATCGTTTAAGTTAGCGGGTGATCAGCTAACCACTTTGGGTGGAAGTCA
ACCGAGCTTACTTGGTATTAACACATTTTGTGGGGAAACCATTCAACAAATTGATGGAAAAATTGAGATT
CAAATAGGACCGCTTAAGCGTCAGCAATATTTAAAATTTTTACCTCATCAAGAGCTTAGCTTAAAGCTCA
AAAAAATCGTAGAAACCTGGTGCAGTCCAACTTTATCGATAGATTTAAGATTGATATTGGATGAGTCTGA
AATACAACCTGTTCGCTTAACTCAAGGCCAAGAAAGTGGCTTAGGGCAAGGCGCTTTTTTAATGTCTCGT
AAGCCTAATACACATAACGATGAAACATGTTATAGCCTTATAGGAGAGCAAATATGA
 Primer design