SecReT6
Protein ID: 126641348
SecReT6 ID195
T6SS typei4b
Gene symbol-
Locus tagA1S_1302
StrainAcinetobacter baumannii ATCC 17978
Repliconchromosome [GenBank: NC_009085] [Browse all T6SS(s) in this replicon]
Location [Strand]1527124..1530249 [+]
Producthypothetical protein
NoteTssM
UniProt IDA3M486
KEGG IDacb:A1S_1302
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.80E-72, Aligned region: 161..424
IcmF-related [PF06761], Evalue: 2.50E-52, Aligned region: 435..458
IcmF-related [PF06761], Evalue: 2.50E-52, Aligned region: 469..810
DUF1215 [PF06744], Evalue: 2.90E-20, Aligned region: 747..770
DUF1215 [PF06744], Evalue: 2.90E-20, Aligned region: 941..1034
Protein Sequence: 1041 a.a.     [Download]
>gi|126641348|ref|YP_001084332.1| hypothetical protein A1S_1302 [Acinetobacter baumannii ATCC 17978]
MSSYTSIPRHIFWDLASAYALGLIAYGIYWLIQRKKHAVQGEELAQAIEKDTQAEYGKNKDKEELQLISQ
QMKESIQLIRKSKLGDKKGNAALYELPWYMVIGNPAAGKSSAIYNSGLKFPFEETHQKMVSAGLSGTRNC
DWFFSTEGILLDTAGRYSVYSEDHSEWLGFLNILKKNRSKAPVNGLILIVSIAELVSQSPEHSLKLAKNL
RARIQDLTERLEVVVPVYLVFSKMDLIAGFTEFFEFYEAQEYNQAWGATLPYEQNSSHNAVDLFEKHYNI
LYDGLKGVSSTHLSRRHSQNISPSVMTFPLEFKTLKPALKSFIATLFEDNPYQFQPVFRGFYFTSALQEG
VIESPMTEQIAQEFQLSQIAQSEVKDQLKTTPNHGYFLKGLFSDVILKDKDLVKQHVNTSKKRQRYIAFI
GALAGVSIILGVWVWSYRNNQQLIAEVQADLNKVVQLEKSSGQQLSTQLEALLVLQRRLQQLDEFDENRP
LKFSFGLYQGNELREKLKAEYLKGVKQIVLIPTQQNIAQYLQRVKNNEATLKANHTNVEIKQTAQTQQYL
EPSDTNPQDAYNALKAYLMMSNPQYMDASHLSDQVTRFWRSWLDANKGQMPRADMIQEAEQILSYAMTLA
NDKQFPILDADSQLVDQTRQVLLSVIRGMPARDRVYNQIKMRAAVRFPALTVSQIVGDANKNIVLGSYAL
PGVFTQKAWNEYVEKAMEEAADKPTDTKDWVLNSRQSDDLTFSGSPEQIRKQLTALYKQEYIAEWRKFLS
GIHYAKATQFAQQVKNIDVLGEPQNSPIRTLIERVAIETNWDNPVVQAELAAPQKGFIAWFKRKVLNHDD
KQLANQAVTNAQGPISQEYQMFYQLVRKRDDQQGKSLLDEYMTNLALVRSKFNELKNAGEIGPNAMTLVK
QTLNEQTSVFNQTQKIVDEKMAVGFSEIDQQLLQKLVVSPLTQAFESLITPTQDEINKLWVMQAYQPFTA
NLAKKYPFNSSASLQATSSEIGQILGENGSISRFVKESLDPFVIRRGYTLTSKHGKIWGLV
 
Nucleotide Sequence: 3126 bp     [Download]
>gi|126640115|ref|NC_009085.1|:1527124-1530249 Acinetobacter baumannii ATCC 17978, complete genome
ATGTCTTCCTATACTTCAATTCCTCGCCATATATTTTGGGATTTAGCATCTGCATATGCTTTAGGGCTCA
TCGCTTATGGAATTTATTGGCTAATTCAGCGTAAAAAGCATGCTGTTCAAGGTGAAGAGCTTGCGCAAGC
GATTGAAAAGGATACCCAAGCAGAGTACGGCAAAAATAAAGATAAAGAAGAGCTGCAACTTATTAGCCAA
CAAATGAAAGAATCTATTCAATTGATTCGTAAGTCAAAGTTAGGCGATAAAAAGGGGAACGCAGCACTAT
ATGAGTTGCCATGGTATATGGTCATTGGTAACCCGGCTGCTGGTAAAAGTTCTGCGATCTATAATTCCGG
TTTAAAGTTTCCTTTTGAAGAAACCCATCAAAAAATGGTTTCGGCTGGTTTAAGCGGTACGCGTAATTGT
GACTGGTTTTTTTCAACTGAGGGTATTTTACTCGACACCGCTGGACGTTATTCAGTCTATAGCGAAGATC
ACTCTGAATGGTTAGGCTTTTTAAATATCTTAAAGAAGAACCGTTCGAAGGCTCCAGTAAATGGTTTAAT
TCTTATTGTTAGTATTGCTGAGCTTGTTAGTCAGAGTCCAGAACACTCATTAAAGCTTGCGAAAAATTTA
CGCGCTCGTATTCAGGATTTAACTGAACGTTTAGAAGTGGTTGTACCCGTATATCTAGTCTTTTCAAAAA
TGGATTTGATCGCGGGTTTTACTGAATTTTTCGAATTCTATGAAGCACAAGAATATAATCAGGCGTGGGG
TGCAACACTACCATATGAGCAAAACTCTTCTCATAATGCTGTAGATCTTTTTGAGAAACACTACAATATT
CTTTATGACGGTTTAAAAGGGGTCAGTTCAACTCATCTTAGCCGTCGACATTCTCAAAATATCTCACCTA
GTGTGATGACTTTCCCATTAGAATTTAAGACATTAAAACCTGCATTAAAAAGTTTTATTGCGACACTGTT
TGAAGATAACCCTTACCAGTTCCAACCAGTTTTCCGTGGGTTTTATTTCACGAGTGCTTTGCAAGAAGGC
GTAATAGAAAGTCCAATGACTGAGCAAATTGCACAGGAATTCCAGCTTTCCCAAATTGCTCAAAGTGAAG
TAAAAGATCAACTAAAAACAACGCCTAACCATGGTTATTTCTTAAAAGGCTTGTTTTCAGATGTCATTTT
AAAAGATAAAGATCTGGTTAAACAGCATGTCAATACAAGCAAAAAGCGTCAGCGTTATATTGCATTTATT
GGTGCTTTAGCTGGCGTATCCATTATTCTAGGTGTGTGGGTTTGGTCATATCGTAACAATCAACAACTTA
TTGCTGAAGTTCAAGCTGATTTAAATAAAGTTGTTCAATTGGAAAAGAGTTCAGGTCAACAATTGTCGAC
TCAATTAGAGGCCTTACTTGTCTTGCAAAGACGTCTACAACAGTTAGACGAATTTGATGAAAATAGACCA
CTAAAATTTAGTTTTGGTTTATATCAAGGTAATGAGCTACGTGAAAAATTAAAAGCTGAATATTTAAAAG
GTGTTAAGCAAATTGTTTTGATACCTACACAGCAAAATATTGCTCAGTATTTGCAACGTGTAAAAAATAA
CGAAGCAACTTTAAAAGCAAATCATACCAATGTTGAGATCAAGCAAACTGCTCAAACTCAGCAATATTTA
GAGCCTTCGGATACCAACCCTCAAGATGCTTATAATGCTTTAAAAGCATATTTAATGATGAGCAATCCAC
AGTATATGGATGCAAGTCACTTAAGTGATCAGGTAACGCGTTTCTGGCGTTCTTGGCTTGATGCCAATAA
AGGGCAGATGCCACGTGCAGATATGATCCAAGAAGCTGAGCAGATCTTATCTTATGCAATGACATTGGCA
AATGATAAACAATTCCCGATCTTGGATGCTGACTCTCAACTCGTGGATCAGACACGTCAAGTATTGCTCT
CTGTTATTAGAGGTATGCCAGCACGTGACCGTGTTTATAATCAAATTAAAATGCGTGCTGCTGTGCGCTT
TCCAGCTTTAACTGTAAGCCAGATTGTAGGTGATGCAAATAAAAATATTGTATTGGGTAGTTATGCATTA
CCAGGGGTATTTACTCAAAAAGCTTGGAACGAGTATGTAGAAAAAGCAATGGAGGAAGCAGCAGACAAAC
CTACGGATACTAAAGACTGGGTGCTTAATAGCCGTCAATCTGATGATTTAACTTTTTCTGGTAGTCCAGA
GCAAATCAGAAAGCAGCTTACTGCATTGTATAAACAAGAATATATTGCAGAGTGGAGAAAATTCTTAAGT
GGTATTCACTATGCAAAAGCAACTCAGTTTGCTCAGCAAGTTAAAAATATTGATGTATTGGGCGAACCAC
AAAATTCACCAATTCGCACACTTATTGAACGCGTAGCCATTGAAACAAATTGGGATAATCCGGTCGTTCA
AGCCGAGTTAGCAGCACCTCAAAAAGGATTTATTGCATGGTTTAAACGTAAGGTTTTAAACCATGATGAT
AAACAATTAGCAAATCAGGCTGTAACGAATGCTCAAGGGCCTATTTCTCAAGAATATCAAATGTTCTATC
AATTGGTTCGTAAACGTGATGATCAGCAAGGTAAATCTTTGCTTGATGAATATATGACGAATCTTGCCTT
AGTACGTAGTAAGTTTAATGAACTTAAGAATGCGGGTGAGATCGGACCGAATGCGATGACATTGGTTAAG
CAAACTTTAAATGAGCAGACATCGGTATTTAACCAGACTCAAAAAATTGTAGATGAAAAGATGGCGGTTG
GTTTCAGTGAAATTGATCAGCAACTTCTACAAAAATTAGTGGTGAGTCCACTTACCCAAGCCTTTGAAAG
TTTAATTACACCTACTCAAGATGAAATTAATAAGCTATGGGTAATGCAAGCCTATCAACCATTTACTGCA
AATCTTGCTAAGAAATATCCATTTAACTCATCAGCTTCTTTACAAGCAACAAGTAGTGAAATTGGACAAA
TTCTTGGTGAAAACGGCAGTATTTCCCGTTTTGTTAAAGAGAGTTTAGATCCGTTTGTTATCCGCCGTGG
TTATACTTTAACTTCAAAACATGGAAAGATTTGGGGATTAGTTTAA
 Primer design