SecReT6
Protein ID: 126641349
SecReT6 ID195
T6SS typei4b
Gene symbol-
Locus tagA1S_1303
StrainAcinetobacter baumannii ATCC 17978
Repliconchromosome [GenBank: NC_009085] [Browse all T6SS(s) in this replicon]
Location [Strand]1530300..1530866 [+]
Producthypothetical protein
NoteTssM
UniProt IDA3M487
KEGG IDacb:A1S_1303
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 188 a.a.     [Download]
>gi|126641349|ref|YP_001084333.1| hypothetical protein A1S_1303 [Acinetobacter baumannii ATCC 17978]
MATGELNSQAPAAPATNQSNFQFYPIQNPQLLSYTVDIDGQRMTYENGVQQWVNFIWPNQGSIPGARITA
VDLQGQTHTIFDEPGEYGINRLIDSAQRKEQNGGFEMLWRSKTDPSLFVKMNFRLISSNSGSIGSSRGYS
GMQLVDKVTADKAARVVSAQQAPAQAAAPAKTENPVSALAQPAAGVKP
 
Nucleotide Sequence: 567 bp     [Download]
>gi|126640115|ref|NC_009085.1|:1530300-1530866 Acinetobacter baumannii ATCC 17978, complete genome
ATGGCAACAGGTGAGTTAAATAGCCAAGCACCAGCTGCTCCGGCAACCAATCAGTCTAACTTCCAGTTCT
ACCCAATTCAAAACCCGCAATTACTTTCATATACCGTTGATATTGATGGTCAGCGTATGACTTATGAAAA
TGGGGTGCAGCAATGGGTTAACTTTATTTGGCCAAATCAAGGCAGTATTCCGGGTGCTCGTATTACAGCT
GTAGATTTACAAGGTCAAACACATACCATTTTTGATGAACCAGGCGAATACGGGATTAACCGTTTAATCG
ATAGTGCACAGCGTAAAGAGCAAAACGGTGGTTTTGAAATGCTTTGGCGCAGTAAGACAGATCCATCACT
CTTTGTGAAAATGAACTTCCGTCTTATTAGTAGTAATTCAGGAAGTATCGGTTCAAGCCGTGGCTACTCT
GGTATGCAACTGGTTGACAAAGTAACTGCGGATAAGGCTGCTCGCGTTGTATCCGCACAGCAAGCACCAG
CTCAGGCAGCTGCTCCTGCCAAAACTGAAAATCCAGTTTCTGCACTAGCACAACCTGCTGCGGGAGTTAA
GCCATGA
 Primer design