SecReT6
Protein ID: 126641351
SecReT6 ID195
T6SS typei4b
Gene symbol-
Locus tagA1S_1305
StrainAcinetobacter baumannii ATCC 17978
Repliconchromosome [GenBank: NC_009085] [Browse all T6SS(s) in this replicon]
Location [Strand]1532004..1532633 [+]
Productputative outer membrane lipoprotein
NoteTagL
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 9.40E-25, Aligned region: 108..202
Protein Sequence: 209 a.a.     [Download]
>gi|126641351|ref|YP_001084335.1| putative outer membrane lipoprotein [Acinetobacter baumannii ATCC 17978]
MKMQSVYGADQVVDKIQVRPVAAPNGWSDSVTRVITPDLKKVSQGKLSVNGTRFELTGKMLNPTEIQPTI
QSFQSLVQPPYQLFSQLSVNQAEQKIIDDALKNRIIEFESGSAVLTEAGQKILDEMAVALNKVGGKKVKI
VGHTDSSGDANKNLKLSQDRALAVKNYLISKNIPADHLSTEGLGSSKPVADNTSAEGRKKNRRIEFTVL
 
Nucleotide Sequence: 630 bp     [Download]
>gi|126640115|ref|NC_009085.1|:1532004-1532633 Acinetobacter baumannii ATCC 17978, complete genome
ATGAAAATGCAGTCTGTTTATGGTGCAGATCAAGTTGTTGATAAAATACAAGTTCGACCAGTTGCCGCTC
CAAATGGATGGAGTGACTCTGTCACACGAGTGATTACACCTGATCTTAAAAAAGTTTCTCAGGGTAAGTT
AAGTGTTAATGGAACCCGATTTGAACTGACCGGGAAAATGCTAAATCCGACAGAAATACAGCCAACCATT
CAGTCTTTTCAGAGTTTGGTACAGCCTCCATATCAATTATTTTCCCAGCTTTCTGTAAATCAGGCTGAGC
AGAAGATTATTGATGATGCTTTAAAAAATCGAATTATTGAATTTGAATCTGGTAGTGCAGTATTAACTGA
AGCTGGGCAAAAAATTCTTGATGAAATGGCTGTTGCTTTAAATAAAGTGGGCGGGAAAAAAGTCAAAATT
GTGGGGCATACCGATAGTTCTGGTGATGCGAACAAAAACTTAAAACTCAGCCAAGATCGAGCTTTGGCAG
TTAAAAATTACTTAATTAGTAAGAATATTCCTGCTGATCATTTATCTACCGAAGGTTTAGGTTCATCTAA
GCCTGTAGCGGACAATACTTCTGCGGAAGGTAGAAAGAAAAACCGCCGAATTGAGTTCACCGTTTTATAG
 Primer design